The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV
LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV
LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ
LKKYIEHVRELPNIKKWIAERPKTPY
Sequence Info Allergen Name Length Opt Bits Score E Value
P46436 Asc l 13.0101w 206 1385 386.4 3.4e-109
P46436 Asc s 13.0101 206 1385 386.4 3.4e-109
O18598 Bla g 5 203 447 128.5 1.4e-31
AAB72147 Bla g 5 200 437 125.8 8.9e-31
AGG10560 Tyr p 8.0101 218 170 52.3 1.3e-08
C8CGT7 Blo t 8.0101 236 152 47.3 4.5e-07
AGC56215 Der f 8.0101 197 147 46.1 8.6e-07
AUW37958 Per a 5.0101 216 134 42.4 1.2e-05
P46419 Der p 8 219 134 42.4 1.2e-05
AEV23867 Per a 5.0102 216 125 40.0 6.7e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asc l 13.0101w Sequence ID: P46436

 Score = 386.4 bits 1385,  Expect = 3e-109
 Identities = 206/206 100%, Positives = 206/206 100%, Gaps = 0/206 0%
Query  1    MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV 60
            MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV
Sbjct  1    MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV 60
Query  61   LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV 120
            LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV
Sbjct  61   LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV 120
Query  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ 180
            LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ
Sbjct  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ 180
Query  181  LKKYIEHVRELPNIKKWIAERPKTPY 206
            LKKYIEHVRELPNIKKWIAERPKTPY
Sbjct  181  LKKYIEHVRELPNIKKWIAERPKTPY 206

Sequence Alignment: 2. Allergen Name: Asc s 13.0101 Sequence ID: P46436

 Score = 386.4 bits 1385,  Expect = 3e-109
 Identities = 206/206 100%, Positives = 206/206 100%, Gaps = 0/206 0%
Query  1    MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV 60
            MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV
Sbjct  1    MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEV 60
Query  61   LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV 120
            LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV
Sbjct  61   LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV 120
Query  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ 180
            LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ
Sbjct  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQ 180
Query  181  LKKYIEHVRELPNIKKWIAERPKTPY 206
            LKKYIEHVRELPNIKKWIAERPKTPY
Sbjct  181  LKKYIEHVRELPNIKKWIAERPKTPY 206

Sequence Alignment: 3. Allergen Name: Bla g 5 Sequence ID: O18598

 Score = 128.5 bits 447,  Expect = 1e-31
 Identities = 80/196 40%, Positives = 113/196 57%, Gaps = 11/196 5%
Query  2    PQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEVL 61
            P YKLTY  ++ LGE  R+++      FED R++  DWP LKP  PFG+ P+LE+DG+  
Sbjct  2    PSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQT 61
Query  62   AQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV- 120
             QS AI RYLG+QFGL+GK   E  ++D I D   DF A +   +   A  +E  K+K  
Sbjct  62   HQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAI-ANYHYDA--DENSKQKKW 118
Query  121  --LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIP-DFLSG 177
              LK+  +P   K +  + K  A  G  Y+    +TWAD+     L     +   D+++ 
Sbjct  119  DPLKKETIPYYTKKFDEVVK--ANGG--YLAAGKLTWADFYFVAILDYLNHMAKEDLVAN 174
Query  178  HLQLKKYIEHVRELPNIKKWIAERPKT 204
            +  LK   E V  LP IK W+A+RP T
Sbjct  175  QPNLKALREKVLGLPAIKAWVAKRPPT 201

Sequence Alignment: 4. Allergen Name: Bla g 5 Sequence ID: AAB72147

 Score = 125.8 bits 437,  Expect = 9e-31
 Identities = 79/194 40%, Positives = 112/194 57%, Gaps = 11/194 5%
Query  4    YKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEVLAQ 63
            YKLTY  ++ LGE  R+++      FED R++  DWP LKP  PFG+ P+LE+DG+   Q
Sbjct  1    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 60
Query  64   SAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV--- 120
            S AI RYLG+QFGL+GK   E  ++D I D   DF A +   +   A  +E  K+K    
Sbjct  61   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAI-ANYHYDA--DENSKQKKWDP 117
Query  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIP-DFLSGHL 179
            LK+  +P   K +  + K  A  G  Y+    +TWAD+     L     +   D+++ + 
Sbjct  118  LKKETIPYYTKKFDEVVK--ANGG--YLAAGKLTWADFYFVAILDYLNHMAKEDLVANQP 173
Query  180  QLKKYIEHVRELPNIKKWIAERPKT 204
             LK   E V  LP IK W+A+RP T
Sbjct  174  NLKALREKVLGLPAIKAWVAKRPPT 198

Sequence Alignment: 5. Allergen Name: Tyr p 8.0101 Sequence ID: AGG10560

 Score = 52.3 bits 170,  Expect = 1e-08
 Identities = 67/188 35%, Positives = 100/188 53%, Gaps = 20/188 10%
Query  6    LTYFDIRGLGEGARLIFHQAGVKFEDNRLK------REDWPALKPKT--PFGQLPLLEVD 57
            L Y+DIRGL +  RL++    V +ED R +      R  W   K      F  LP   +D
Sbjct  7    LGYWDIRGLAQPIRLLLAYLDVDYEDKRYQLGANFDRSAWLTEKFNLGLDFPNLPYY-ID 65
Query  58   GEV-LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGD 116
            G V L+Q+ AI RY+GR++ L G    EE +V  +  Q  D    L    RV A     D
Sbjct  66   GNVKLSQTLAILRYIGRKYKLTGANEPEELRVSLVEQQVVDGNQSLS---RV-AYDPNAD 121
Query  117  KEKVLKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLS 176
            K K      +P   K+   L  FL    S ++ G S+T+ D+ + + L     L+P+ + 
Sbjct  122  KLKPDFLKTLPDSVKQ---LSHFLGN--SPFVAGTSITYVDFWLYEYLVKLSVLVPEVFG 176
Query  177  GHLQLKKYIEHVRELPNIKKWI-AERPK 203
                LKK++E +  LP +  +I A++PK
Sbjct  177  QFDNLKKFVERIESLPRVSVYIKAQQPK 204

Sequence Alignment: 6. Allergen Name: Blo t 8.0101 Sequence ID: C8CGT7

 Score = 47.3 bits 152,  Expect = 5e-07
 Identities = 57/192 29%, Positives = 102/192 53%, Gaps = 28/192 14%
Query  1    MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRL-----------KREDWPALKPKT--P 47
            M   K+ Y+D+RG+ E  R+++ +  ++FE+ R             R++W A K      
Sbjct  1    MAPLKIGYWDVRGFAEPIRMLLKHLNIEFEETRYGFGNDSEESLPNRDEWLAEKFTLGLE 60
Query  48   FGQLPLLEVDGEV-LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCF 106
            F  LP L  DG+  + +S AI + L R  G+   T    +  + I     D    L    
Sbjct  61   FPNLPYL-FDGDFKMTESVAILKRLARANGMIATTEPALSYSEMIEAMIIDIRNRL---I 116
Query  107  RVLAGFEEGDKEKVLKEVAVPARDK---HLPLLEKFLAKSGSEYMVGKSVTWADLVITDS 163
             V+     G  E+  +++A   R++    L  LE F+ K GS+++ G  +T+ D++  + 
Sbjct  117  NVVYAENSGTPEEFEQKLA-DLRERLETSLGQLEAFFQKHGSQWVAGDKLTYVDFLAYEY 175
Query  164  LASWESLI----PDFLSGHLQLKKYIEHVRELPNIKKWIA 199
            L  W  +     P F     ++  Y++   ELP++K++IA
Sbjct  176  L-DWYRVFVKSTPIF-EKFAKVSDYMKRFEELPSLKEYIA 213

Sequence Alignment: 7. Allergen Name: Der f 8.0101 Sequence ID: AGC56215

 Score = 46.1 bits 147,  Expect = 9e-07
 Identities = 59/170 34%, Positives = 97/170 57%, Gaps = 23/170 13%
Query  25   AGVKFEDNR------LKREDWPALKPKTPFG-QLPLLE--VDGEV-LAQSAAIYRYLGRQ 74
            AGV + D R      + R +W  L  K  +G  +P L   +DG+V + QS AI RYL R+
Sbjct  5    AGVDYVDKRYNIGPNFDRSEW--LNEKFNLGLDFPNLPYYMDGDVKITQSMAILRYLARK 62
Query  75   FGLAGKTPMEEAQVDSIFDQFKD-FMAELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHL 133
            + + G    E  ++     Q  D FMA +R C+       E  +   LK   +P  D  L
Sbjct  63   YNMDGTNEQERLRISMAEQQTHDMFMAMVRICY---DPNMENLRVDYLK--TLP--DS-L 114
Query  134  PLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQLKKYIEHVRELPN 193
             L+EKFLA    +Y+ G  +++AD+ + + L   + ++P+       LKK++E +  LP 
Sbjct  115  KLMEKFLANH--DYIAGSKISYADFYLYEYLCRMKVMVPEVYGQFENLKKFVERIESLPR 172
Query  194  IKKWIAERPKTPY 206
            I ++I ++  T +
Sbjct  173  IAEYIKKQKPTTF 185

Sequence Alignment: 8. Allergen Name: Per a 5.0101 Sequence ID: AUW37958

 Score = 42.4 bits 134,  Expect = 1e-05
 Identities = 39/147 26%, Positives = 71/147 48%, Gaps = 7/147 4%
Query  40   PALKPKTPFGQLPLLEVDGEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFM 99
            P +    P   +P L  +G  L +S AI  YL  Q+G       ++A+  ++ DQ   F 
Sbjct  43   PEFLKMNPQHTIPTLNDNGFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYF- 101
Query  100  AELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAK--SGSEYMVGKSVTWAD 157
             ++R  +  +   E        K+ A P + K L    +FL K     E++ G  +T AD
Sbjct  102  -DIRTLYHRFG--EYYYPIYFAKQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIAD 158
Query  158  LVITDSLASWESLIPDFLSGHLQLKKYIEHVREL 191
            L I  S+++ + +  D +S +  + K+ E  +++
Sbjct  159  LAIVSSVSTADIMGFD-VSKYSNVAKWFEKCKKI 191

Sequence Alignment: 9. Allergen Name: Der p 8 Sequence ID: P46419

 Score = 42.4 bits 134,  Expect = 1e-05
 Identities = 66/190 34%, Positives = 111/190 58%, Gaps = 30/190 15%
Query  1    MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLK--------REDWPALKPKTPFG-QL 51
            M Q  L Y+DIRG  +  RL++  +GV F D R +        R +W  L  K  +G  +
Sbjct  1    MSQPILGYWDIRGYAQPIRLLLTYSGVDFVDKRYQIGPAPDFDRSEW--LNEKFNLGLDF 58
Query  52   PLLE--VDGEV-LAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAEL-RPCFR 107
            P L   +DG++ + Q+ AI RYLGR++ L G    EE ++     Q +D MA + R C+ 
Sbjct  59   PNLPYYIDGDMKMTQTFAILRYLGRKYKLNGSNDHEEIRISMAEQQTEDMMAAMIRVCYD 118
Query  108  VLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAKSGSE--YMVGKSVTWADLVITDSLA 165
                    DK K       P   K LP   K+++K   E  ++ G ++++ D+ + + L 
Sbjct  119  A-----NCDKLK-------PDYLKSLPDCLKLMSKFVGEHAFIAGANISYVDFNLYEYLC 166
Query  166  SWESLIPDFLSGHLQLKKYIEHVRELPNIKKWIA-ERPKT 204
              + ++P+ +     LK+Y+E +  LP +  +I  ++PKT
Sbjct  167  HVKVMVPEVFGQFENLKRYVERMESLPRVSDYIKKQQPKT 206

Sequence Alignment: 10. Allergen Name: Per a 5.0102 Sequence ID: AEV23867

 Score = 40.0 bits 125,  Expect = 7e-05
 Identities = 41/146 28%, Positives = 70/146 47%, Gaps = 9/146 6%
Query  40   PALKPKTPFGQLPLLEVDGEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDF- 98
            P +    P   +P L  +G  L +S AI  YL  Q+G       ++A+  ++ DQ   F 
Sbjct  43   PEFLKMNPQHTIPTLNDNGFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFD 102
Query  99   MAELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAK--SGSEYMVGKSVTWA 156
            +  L   F    G E        K+ A P + K L    +FL K     E++ G  +T A
Sbjct  103  IGTLYHRF----G-EYYYPIYFAKQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIA 157
Query  157  DLVITDSLASWESLIPDFLSGHLQLKKYIEHVREL 191
            DL I  S+++ + +  D +S +  + K+ E  +++
Sbjct  158  DLAIVSSVSTADIMGFD-VSKYSNVAKWFEKCKKI 191

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.