The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MQYLAIAVIVALAGLSAAAHKPAYYDDNMANQMVDQIVKSLTTKKELDPFKIEQTKVPID
KKIGLIHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLGDKNIRIKTDLHLD
LGKIIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVD
VIADSFVKYFNPQARKLVTDMLKPILVEEIKKLKLN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9U1G2 Lep d 7 216 1380 321.4 1.4e-89
ABM53750 Tyr p 7.0101 212 619 147.9 2.2e-37
ASX95438 Blo t 7.0101 195 560 134.5 2.2e-33
P49273 Der p 7 215 359 88.6 1.6e-19
Q26456 Der f 7 213 346 85.7 1.2e-18
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lep d 7 Sequence ID: Q9U1G2

 Score = 321.4 bits 1380,  Expect = 1e-89
 Identities = 216/216 100%, Positives = 216/216 100%, Gaps = 0/216 0%
Query  1    MQYLAIAVIVALAGLSAAAHKPAYYDDNMANQMVDQIVKSLTTKKELDPFKIEQTKVPID 60
            MQYLAIAVIVALAGLSAAAHKPAYYDDNMANQMVDQIVKSLTTKKELDPFKIEQTKVPID
Sbjct  1    MQYLAIAVIVALAGLSAAAHKPAYYDDNMANQMVDQIVKSLTTKKELDPFKIEQTKVPID 60
Query  61   KKIGLIHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLGDKNIRIKTDLHLD 120
            KKIGLIHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLGDKNIRIKTDLHLD
Sbjct  61   KKIGLIHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLGDKNIRIKTDLHLD 120
Query  121  LGKIIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVD 180
            LGKIIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVD
Sbjct  121  LGKIIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVD 180
Query  181  VIADSFVKYFNPQARKLVTDMLKPILVEEIKKLKLN 216
            VIADSFVKYFNPQARKLVTDMLKPILVEEIKKLKLN
Sbjct  181  VIADSFVKYFNPQARKLVTDMLKPILVEEIKKLKLN 216

Sequence Alignment: 2. Allergen Name: Tyr p 7.0101 Sequence ID: ABM53750

 Score = 147.9 bits 619,  Expect = 2e-37
 Identities = 97/204 47%, Positives = 149/204 73%, Gaps = 9/204 4%
Query  5    AIAVIVA-LAGLSAAAHKPAYYDDNMANQMVDQIVKSLTTKKELDPFKIEQTKVPIDKKI 63
            A+ V+VA +AG++ A       D+  ANQ VDQIV +L T+K +DP+ I    + ID+KI
Sbjct  4    AVLVLVACFAGIAVA-------DNGNANQFVDQIVTALKTQKNFDPLVIPPHHMNIDRKI 56
Query  64   GLIHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLGDKNIRIKTDLHLD-LG 122
            G IH+KG+A +K   ITGLSH+ R GDA +  + G+F A L LGD N+++ +D+ L  L 
Sbjct  57   GAIHLKGTADLKETKITGLSHVRRVGDALLKNENGSFTAKLHLGDDNVKLFSDISLHFLH 116
Query  123  KIIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVDVI 182
             IIHPNLK E  IG+I + + + + A+GKP+L  F+I+EF++V++ +HGLGPLD LVD+I
Sbjct  117  NIIHPNLKVEIDIGNIGVGFGVTIGADGKPALKDFDIEEFKHVKIHVHGLGPLDHLVDLI 176
Query  183  ADSFVKYFNPQARKLVTDMLKPILVEEIKKLKL 215
             ++++   N QAR ++T +++PIL +E+K +K+
Sbjct  177  GEAYISLANTQARHMITGIVRPILDQELKNFKM 209

Sequence Alignment: 3. Allergen Name: Blo t 7.0101 Sequence ID: ASX95438

 Score = 134.5 bits 560,  Expect = 2e-33
 Identities = 81/188 43%, Positives = 130/188 69%, Gaps = 2/188 1%
Query  27   DNMANQMVDQIVKSLTTKKELDPFKIEQTKVPIDKKIGLIHIKGSATIKNAVITGLSHIS 86
            D+ ANQ+VDQ+V +L T+K +DP  + +    +D+KIGL+  KG   IK+A +TGLS  +
Sbjct  1    DDAANQLVDQVVDALKTQKGFDPMHVGKHTTELDRKIGLVTFKGKLIIKDATVTGLSRAA 60
Query  87   RRGDAKIDTDGGAFAATLKLGDKNIRIKTDLHLDLGKIIHPNLKFEGHIGDIDMKLKLKL 146
            R GDAKI  + G F ATL+LGD ++++ +++ L +G +I+ +L ++  IG + + +   L
Sbjct  61   RVGDAKIHNENGDFVATLELGDSDVKMHSNIELIVG-LIQSHLTLDVDIGKLQIMFSAGL 119
Query  147  DAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVDVIADSFVKYFNPQARKLVTDMLKPIL 206
             AEG PS+  F IDEFE V + +HGLGPLDP++D+I D+ +   N Q R++++ M++PI+
Sbjct  120  AAEG-PSVKDFHIDEFEAVRIHVHGLGPLDPFIDIIGDAIITLANSQVREMISTMMRPII 178
Query  207  VEEIKKLKLN 216
              E+KK+  N
Sbjct  179  ESEVKKFLQN 188

Sequence Alignment: 4. Allergen Name: Der p 7 Sequence ID: P49273

 Score = 88.6 bits 359,  Expect = 2e-19
 Identities = 62/204 30%, Positives = 110/204 53%, Gaps = 5/204 2%
Query  8    VIVALAGLSAAAHKPAYYDD--NMANQMVDQIVKSLTTKKELDPFKIEQTKVPIDKKIGL 65
            +++A A + A +  P +YD      N+ VD+ V ++   + +DP K+       ++ IG+
Sbjct  5    LLIAAAAFVAVSADPIHYDKITEEINKAVDEAVAAIEKSETFDPMKVPDHSDKFERHIGI 64
Query  66   IHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLG--DKNIRIKTDLHLDLGK 123
            I +KG   ++N  + GL ++ R GDA + ++ G   A L +G  D  + ++ DL   LG 
Sbjct  65   IDLKGELDMRNIQVRGLKQMKRVGDANVKSEDGVVKAHLLVGVHDDVVSMEYDLAYKLGD 124
Query  124  IIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLDPLVDVIA 183
            + HPN      I D  ++L L++  EG  +L  FE+ +F  V   I GL  LDP+  V++
Sbjct  125  L-HPNTHVISDIQDFVVELSLEVSEEGNMTLTSFEVRQFANVVNHIGGLSILDPIFAVLS 183
Query  184  DSFVKYFNPQARKLVTDMLKPILVEEIKK 212
            D +   F    R  +T +L P + +E+++
Sbjct  184  DVLTAIFQDTVRAEMTKVLAPAFKKELER 212

Sequence Alignment: 5. Allergen Name: Der f 7 Sequence ID: Q26456

 Score = 85.7 bits 346,  Expect = 1e-18
 Identities = 63/207 30%, Positives = 109/207 52%, Gaps = 9/207 4%
Query  1    MQYLAIAVIVALAGLSAAAHKPAYYDD--NMANQMVDQIVKSLTTKKELDPFKIEQTKVP 58
            M++L IA  VA+  +SA    P +YD      N+ +D  + ++   + +DP K+      
Sbjct  2    MKFLLIAA-VAFVAVSA---DPIHYDKITEEINKAIDDAIAAIEQSETIDPMKVPDHADK 57
Query  59   IDKKIGLIHIKGSATIKNAVITGLSHISRRGDAKIDTDGGAFAATLKLG--DKNIRIKTD 116
             ++ +G++  KG   ++N    GL ++ R+GDA +  + G   A L +G  D  + ++ D
Sbjct  58   FERHVGIVDFKGELAMRNIEARGLKQMKRQGDANVKGEEGIVKAHLLIGVHDDIVSMEYD 117
Query  117  LHLDLGKIIHPNLKFEGHIGDIDMKLKLKLDAEGKPSLDQFEIDEFEQVELFIHGLGPLD 176
            L   LG + HP       I D  + L L++  EG  ++  FE+ +F  V   I GL  LD
Sbjct  118  LAYKLGDL-HPTTHVISDIQDFVVALSLEISDEGNITMTSFEVRQFANVVNHIGGLSILD 176
Query  177  PLVDVIADSFVKYFNPQARKLVTDMLKPILVEEIKK 212
            P+  V++D +   F    RK +T +L P +  E++K
Sbjct  177  PIFGVLSDVLTAIFQDTVRKEMTKVLAPAFKRELEK 212

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.