The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRKMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGK
GCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQS
GGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSC
GIGPGYCGAGCQSGGCDAVFAGAITANSTLLAE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA34258 Tri a 18 213 1652 249.2 7.1e-68
AAA34256 Tri a 18 212 1556 235.4 1e-63
AAA34257 Tri a 18 186 1433 217.6 2e-58
P02877 Hev b 6.01 204 229 44.3 3.2e-06
Exo m 1.0101 40 210
P0DKH8 Fag e 4.0102 40 210 40.5 8.7e-06
Q42428 Cas s 5 316 220 43.3 1e-05
CAC42881 Hev b 11.0101 295 206 41.2 4e-05
Q8VXF1 Mus a 2.0101 318 206 41.3 4.1e-05
CAB01591 Pers a 1 326 203 40.9 5.7e-05
CAD24068 Hev b 11.0102 295 202 40.7 5.9e-05
P29022 Zea m 8.0101 280 186 38.3 0.00028
P81729 Bra r 2 91 157 33.4 0.0027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 249.2 bits 1652,  Expect = 7e-68
 Identities = 213/213 100%, Positives = 213/213 100%, Gaps = 0/213 0%
Query  1    MRKMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGK 60
            MRKMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGK
Sbjct  1    MRKMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGK 60
Query  61   GCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQS 120
            GCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQS
Sbjct  61   GCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQS 120
Query  121  GGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSC 180
            GGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSC
Sbjct  121  GGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSC 180
Query  181  GIGPGYCGAGCQSGGCDAVFAGAITANSTLLAE 213
            GIGPGYCGAGCQSGGCDAVFAGAITANSTLLAE
Sbjct  181  GIGPGYCGAGCQSGGCDAVFAGAITANSTLLAE 213

Sequence Alignment: 2. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 235.4 bits 1556,  Expect = 1e-63
 Identities = 200/211 94%, Positives = 203/211 96%, Gaps = 0/211 0%
Query  3    KMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGC 62
            KMMST AL LGAA  LAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGC
Sbjct  2    KMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGC 61
Query  63   QNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGG 122
            QNGACWTSKRCGSQAGGATC NN+CCSQYG+CGFGAEYCGAGCQGGPCRADIKCGSQ+GG
Sbjct  62   QNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGG 121
Query  123  KLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGI 182
            KLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGI
Sbjct  122  KLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGI 181
Query  183  GPGYCGAGCQSGGCDAVFAGAITANSTLLAE 213
            GPGYCGAGCQSGGCD VFA AITANSTLL E
Sbjct  182  GPGYCGAGCQSGGCDGVFAEAITANSTLLQE 212

Sequence Alignment: 3. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 217.6 bits 1433,  Expect = 2e-58
 Identities = 176/186 94%, Positives = 179/186 96%, Gaps = 0/186 0%
Query  28   QRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHC 87
            QRCGEQGS MECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGG TCPNNHC
Sbjct  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
Query  88   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGG 147
            CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQ+GGKLCPNNLCCSQWG+CGLGSEFCG G
Sbjct  61   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG 120
Query  148  CQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDAVFAGAITAN 207
            CQ+GACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCD VFA AI  N
Sbjct  121  CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN 180
Query  208  STLLAE 213
            STLLAE
Sbjct  181  STLLAE 186

Sequence Alignment: 4. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 44.3 bits 229,  Expect = 3e-06
 Identities = 34/61 55%, Positives = 41/61 67%, Gaps = 7/61 11%
Query  105  CQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGG--GCQSGACSTDKPCGKD 162
            C  G   A+ +CG Q+GGKLCPNNLCCSQWG+CG   E+C     CQS  C   K  G+ 
Sbjct  10   CLTGVAIAE-QCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSN-C---KDSGEG 64
Query  163  AGGRVCTN 170
             GG   +N
Sbjct  65   VGGGSASN 72

Sequence Alignment: 5. Allergen Name: Exo Sequence ID:

 Score = 40.5 bits 210,  Expect = 9e-06
 Identities = 23/38 60%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  115  KCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGAC 153
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQS  C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39

Sequence Alignment: 6. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 40.5 bits 210,  Expect = 9e-06
 Identities = 23/38 60%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  115  KCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGAC 153
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQS  C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39

Sequence Alignment: 7. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 43.3 bits 220,  Expect = 1e-05
 Identities = 61/162 37%, Positives = 82/162 50%, Gaps = 32/162 19%
Query  16   VFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGS 75
            +FLAF   T+ A++CG Q     C NNLCCSQ+G+CG   +YCG GCQ+       +C S
Sbjct  8    LFLAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-------QCSS 59
Query  76   QAGGATCPNNHCCSQYGHCGFGAEYCGAGC-QGGPCRADIKCGSQSGGKLCPNNLCCSQW 134
                 + P     S  G    G+    +   Q    R D +C  +S G    N +  +  
Sbjct  60   PTTTTSSPTA---SSGGGGDVGSLISASLFDQMLKYRNDPRC--KSNGFYTYNAFIAAAR 114
Query  135  GFCGLGS---------EFCGGGCQSGACSTD----KPCGKDAGGR--VCTNN---YCCSK 176
             F G+G+         E+     Q+   +T      P G  A G   V  NN   YC SK
Sbjct  115  SFNGFGTTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSK 174
Query  177  WGSCGIGPGYCGAG 190
               C  G  Y G G
Sbjct  175  SWPCVFGKQYYGRG 188

Sequence Alignment: 8. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 41.2 bits 206,  Expect = 4e-05
 Identities = 28/49 57%, Positives = 32/49 65%, Gaps = 3/49 6%
Query  71   KRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGG 122
            ++CG QAGGA CP   CCSQYG C    EYCG+GCQ   C  D   G + GG
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGGGGEDGG 49

Sequence Alignment: 9. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 41.3 bits 206,  Expect = 4e-05
 Identities = 48/134 35%, Positives = 59/134 44%, Gaps = 16/134 11%
Query  70   SKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQ---------GGPCRADIKCGSQS 120
            +++CG QAGGA CP   CCSQYG CG    YCG GCQ         GG   A I   S  
Sbjct  19   AEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQSQCGGSGGSGGGSVASIISSSLF 78
Query  121  GGKLCP-NNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKD---AGGRVCTNNYCCSK 176
               L   N+  C   GF    +        SG  +T     K    A     T++     
Sbjct  79   EQMLKHRNDAACPGKGFYTYNAFIAAANSFSGFGTTGDDAKKKREIAAFLAQTSHETTGG 138
Query  177  WGSCGIGP---GYCGAGCQSGGCDAVFAGA 203
            W +   GP   GYC    Q+   D   A +
Sbjct  139  WATAPDGPYAWGYCFVQEQNPSSDYCVASS 168

Sequence Alignment: 10. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 40.9 bits 203,  Expect = 6e-05
 Identities = 52/160 32%, Positives = 69/160 43%, Gaps = 27/160 16%
Query  7    TMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGA 66
            T +L L   +++ + A  A A++CG Q     CP  LCCSQ+G+CG   DYCG  CQ   
Sbjct  5    TASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQ--- 61
Query  67   CWTSKRCGSQAGGAT-CPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLC 125
                    SQ GG T  P     S   +  F         Q    R D  C  Q+ G   
Sbjct  62   --------SQCGGVTPSPGGGVASLISQSVFN--------QMLKHRNDAAC--QAKGFYT 103
Query  126  PNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSC----- 180
             N +  +   F G+ S       +    +       +  G   T       WG C     
Sbjct  104  YNAFIAAANSFNGFASVGDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQ 163
Query  181  GIGPGYC 187
            G  P YC
Sbjct  164  GNPPDYC 170

Sequence Alignment: 11. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 40.7 bits 202,  Expect = 6e-05
 Identities = 26/47 55%, Positives = 32/47 68%, Gaps = 3/47 6%
Query  115  KCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAG 164
            +CG Q+GG LCP  LCCSQ+G+C    E+CG GCQS  C  D   G + G
Sbjct  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGVGGEGG 48

Sequence Alignment: 12. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 38.3 bits 186,  Expect = 0.0003
 Identities = 31/63 49%, Positives = 37/63 58%, Gaps = 7/63 11%
Query  10   LTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWT 69
            L LG   +L  AA  A AQ CG       C  N+CCS++GYCG    YCG GCQ+G C +
Sbjct  8    LALGLLALLCAAAGPAAAQNCG-------CQPNFCCSKFGYCGTTDAYCGDGCQSGPCRS 60
Query  70   SKRCGSQAGG 79
                G   GG
Sbjct  61   GGGGGGGGGG 70

Sequence Alignment: 13. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 33.4 bits 157,  Expect = 0.003
 Identities = 25/56 44%, Positives = 31/56 55%, Gaps = 5/56 8%
Query  76   QAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIK--CGSQSGGKLCPNNLCCSQ 133
            QAGG TC  N CCSQYG+CG  A+YC        C+A       +Q+   L   +  CS 
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPD---NNCQATYHYYNPAQNNWDLRAVSAYCST 57
Query  134  W 134
            W
Sbjct  58   W 58

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.