The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRSRFILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLR
IQCNSPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIR
DLIVSKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGK
CEVLYDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNAN
WESDIRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNV
TLVSVNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSMSNELDSSADS
DEDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKI
NSGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNE
IGSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTAR
TPTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLS
SRRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERV
STYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTR
MAQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHF
TEMEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM
YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD
MVSPRHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSKFDVRL
LTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLDAALQPLKHNSK
TRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSIFSVEVEADNLA
EKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTATLDTKEIRSNNL
DTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAGLEVPGLWKSNH
ACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFDYKKILDSNPTN
EFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVRNSVKDCQKAAEM
AKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEIQEHSDVNDNDIRVQ
IKLSPNMTSAEGMASKSGQILTFSDIHIDMGIDNDDEMNEIEKGILHGATCTLRNNEAET
FDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPENMKVTVIAEETENNKKELQILLG
NDEILFKSSGTEVSAWVNGQKVKCSQKESYQHIKNDETLFEIFELPGPAIKLISDKYDIK
LAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVTPKNCMLQKPEEFAATYILKERCE
GPALNNAKKAERSKCIRKVLRFSDVISDGEAGRPYVNWKQWGYHKKENKKQCNTYRTQII
TKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCLPKNDSSLGMKKRIEQGANPDLSQRT
PTDNAMISVPLECVAT
Sequence Info Allergen Name Length Opt Bits Score E Value
G8IIT0 Ves v 6.0101 1756 11579 2645.3 0
Q868N5 Api m 12.0101 1770 3174 729.4 1.4e-210
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ves v 6.0101 Sequence ID: G8IIT0

 Score = 2645.3 bits 11579,  Expect = 0
 Identities = 1756/1756 100%, Positives = 1756/1756 100%, Gaps = 0/1756 0%
Query  1    MRSRFILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLR 60
            MRSRFILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLR
Sbjct  1    MRSRFILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLR 60
Query  61   IQCNSPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIR 120
            IQCNSPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIR
Sbjct  61   IQCNSPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIR 120
Query  121  DLIVSKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGK 180
            DLIVSKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGK
Sbjct  121  DLIVSKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGK 180
Query  181  CEVLYDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNAN 240
            CEVLYDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNAN
Sbjct  181  CEVLYDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNAN 240
Query  241  WESDIRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNV 300
            WESDIRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNV
Sbjct  241  WESDIRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNV 300
Query  301  TLVSVNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSMSNELDSSADS 360
            TLVSVNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSMSNELDSSADS
Sbjct  301  TLVSVNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSMSNELDSSADS 360
Query  361  DEDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKI 420
            DEDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKI
Sbjct  361  DEDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKI 420
Query  421  NSGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNE 480
            NSGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNE
Sbjct  421  NSGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNE 480
Query  481  IGSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTAR 540
            IGSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTAR
Sbjct  481  IGSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTAR 540
Query  541  TPTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLS 600
            TPTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLS
Sbjct  541  TPTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLS 600
Query  601  SRRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERV 660
            SRRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERV
Sbjct  601  SRRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERV 660
Query  661  STYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTR 720
            STYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTR
Sbjct  661  STYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTR 720
Query  721  MAQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHF 780
            MAQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHF
Sbjct  721  MAQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHF 780
Query  781  TEMEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM 840
            TEMEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM
Sbjct  781  TEMEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM 840
Query  841  YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD 900
            YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD
Sbjct  841  YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD 900
Query  901  MVSPRHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSKFDVRL 960
            MVSPRHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSKFDVRL
Sbjct  901  MVSPRHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSKFDVRL 960
Query  961  LTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLDAALQPLKHNSK 1020
            LTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLDAALQPLKHNSK
Sbjct  961  LTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLDAALQPLKHNSK 1020
Query  1021 TRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSIFSVEVEADNLA 1080
            TRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSIFSVEVEADNLA
Sbjct  1021 TRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSIFSVEVEADNLA 1080
Query  1081 EKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTATLDTKEIRSNNL 1140
            EKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTATLDTKEIRSNNL
Sbjct  1081 EKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTATLDTKEIRSNNL 1140
Query  1141 DTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAGLEVPGLWKSNH 1200
            DTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAGLEVPGLWKSNH
Sbjct  1141 DTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAGLEVPGLWKSNH 1200
Query  1201 ACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFDYKKILDSNPTN 1260
            ACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFDYKKILDSNPTN
Sbjct  1201 ACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFDYKKILDSNPTN 1260
Query  1261 EFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVRNSVKDCQKAAEM 1320
            EFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVRNSVKDCQKAAEM
Sbjct  1261 EFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVRNSVKDCQKAAEM 1320
Query  1321 AKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEIQEHSDVNDNDIRVQ 1380
            AKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEIQEHSDVNDNDIRVQ
Sbjct  1321 AKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEIQEHSDVNDNDIRVQ 1380
Query  1381 IKLSPNMTSAEGMASKSGQILTFSDIHIDMGIDNDDEMNEIEKGILHGATCTLRNNEAET 1440
            IKLSPNMTSAEGMASKSGQILTFSDIHIDMGIDNDDEMNEIEKGILHGATCTLRNNEAET
Sbjct  1381 IKLSPNMTSAEGMASKSGQILTFSDIHIDMGIDNDDEMNEIEKGILHGATCTLRNNEAET 1440
Query  1441 FDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPENMKVTVIAEETENNKKELQILLG 1500
            FDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPENMKVTVIAEETENNKKELQILLG
Sbjct  1441 FDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPENMKVTVIAEETENNKKELQILLG 1500
Query  1501 NDEILFKSSGTEVSAWVNGQKVKCSQKESYQHIKNDETLFEIFELPGPAIKLISDKYDIK 1560
            NDEILFKSSGTEVSAWVNGQKVKCSQKESYQHIKNDETLFEIFELPGPAIKLISDKYDIK
Sbjct  1501 NDEILFKSSGTEVSAWVNGQKVKCSQKESYQHIKNDETLFEIFELPGPAIKLISDKYDIK 1560
Query  1561 LAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVTPKNCMLQKPEEFAATYILKERCE 1620
            LAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVTPKNCMLQKPEEFAATYILKERCE
Sbjct  1561 LAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVTPKNCMLQKPEEFAATYILKERCE 1620
Query  1621 GPALNNAKKAERSKCIRKVLRFSDVISDGEAGRPYVNWKQWGYHKKENKKQCNTYRTQII 1680
            GPALNNAKKAERSKCIRKVLRFSDVISDGEAGRPYVNWKQWGYHKKENKKQCNTYRTQII
Sbjct  1621 GPALNNAKKAERSKCIRKVLRFSDVISDGEAGRPYVNWKQWGYHKKENKKQCNTYRTQII 1680
Query  1681 TKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCLPKNDSSLGMKKRIEQGANPDLSQRT 1740
            TKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCLPKNDSSLGMKKRIEQGANPDLSQRT
Sbjct  1681 TKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCLPKNDSSLGMKKRIEQGANPDLSQRT 1740
Query  1741 PTDNAMISVPLECVAT 1756
            PTDNAMISVPLECVAT
Sbjct  1741 PTDNAMISVPLECVAT 1756

Sequence Alignment: 2. Allergen Name: Api m 12.0101 Sequence ID: Q868N5

 Score = 729.4 bits 3174,  Expect = 1e-210
 Identities = 712/1740 40%, Positives = 1121/1740 64%, Gaps = 40/1740 2%
Query  5    FILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLRIQCN 64
            ++LL L +    +  + +H W+VG EY YLVRSRTLT L  LSD + GIL+KA L +Q  
Sbjct  2    LLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQAK 61
Query  65   SPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIRDLIV 124
              + L A++   QYA++++ +PDGW++ ISDQMLE + LP+S +PF I++KHG+IRDLIV
Sbjct  62   DSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLIV 121
Query  125  SKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGKCEVL 184
             ++VPTWEVNI+KSI+ Q+Q DTQGEN     + Q+P DD P+A+F+ MED V GKCEVL
Sbjct  122  DRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEVL 181
Query  185  YDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNANWESD 244
            YD+ PL++ V++  P ++P P L+G+G H+ + K +N+D C+QR++Y+FG++ N+  E  
Sbjct  182  YDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEPG 241
Query  245  IRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNVTLVS 304
               N K   +SSTS +VIS +LK+F IQ++VTT+++++ PRL D Q  +V+S+MN+TL  
Sbjct  242  TNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLAK 301
Query  305  VNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSM--SNELDSSADS-D 361
            + K S P+P  +NPESTGNLVY YN+PFS   +RR+ + +++ N +   N L SS +   
Sbjct  302  MEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKLK 361
Query  362  EDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKIN 421
            +D+  +R     S   ++ S E+  F Q KPTL +AP+N +LP F+G  GK +  S K++
Sbjct  362  QDILNLRTDISSSSS-SISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD 420
Query  422  SGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNEI 481
                   L+ +IA+E+ED + +P   TLEKF I+  L+ +M+ +QI++ E +++   NE+
Sbjct  421  VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL 480
Query  482  GSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTART 541
              ++ +++ K+N   VFRDAI   GTGPA++TIK WIE+   +  EAA++++ +PKT RT
Sbjct  481  KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT 540
Query  542  PTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLSS 601
            PT  Y+ +FF L  NP+V  +  LN++A LSF E++H AQV+  SI+N+YPV+ FGRL+S
Sbjct  541  PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS 600
Query  602  RRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERVS 661
            + ++++  +YIPF+  EL+KA ++ DSPRIQ YI+ALG+ G PKIL+V+EPYLEGK++++
Sbjct  601  KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT 660
Query  662  TYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTRM 721
             +QR LMV SL KL E  P LARSVLYKIYLNT + H++RC AV L+M+TNPPL ML RM
Sbjct  661  VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM 720
Query  722  AQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHFT 781
            A+FT  D + QVNSAVKS I+S   L  PEW++L + AR V HL+      Y  S  +  
Sbjct  721  AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID 780
Query  782  E-MEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM 840
            E + EN  +   M+LNY+GS D+VIP   ++    S      P  ++   ISSVKS++E+
Sbjct  781  EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL 840
Query  841  YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD 900
                 +  +T  S AEK A+ L I  + +  +EGN+     Y  ++F FD H +++ L  
Sbjct  841  SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDK-LPT 899
Query  901  MVSP-----RHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSK 955
            ++S      +    +N+N L +Y+   SFPTETGLPFVY+++V  + K S   +  +   
Sbjct  900  LISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPD 959
Query  956  F------DVRLLTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLD 1009
            F      ++RL  S   QGRVGF+TPF+H+ F+SGID+N++V+ P K+ + +N  K  + 
Sbjct  960  FAFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQ 1019
Query  1010 AALQPLKHNSKTRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSI 1069
              + P+K   K+RL H+SV+P+ S ++I++LRPL +EK T  +     T + +P+N    
Sbjct  1020 WKIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGP- 1078
Query  1070 FSVEVEADNLAEKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTAT 1129
            F + VE     E++ + + +E   + +  P ++    Y K+D+++  + ++ + V F+ +
Sbjct  1079 FRLNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTS 1138
Query  1130 LDTKEIRSNNLDTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAG 1189
            +D+K +     DT+ E+W      ++   +  +S  RR+E ++E  +GI S K+YV+D  
Sbjct  1139 FDSKVMTRP--DTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVR 1196
Query  1190 LEVPGLWKSNHACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFD 1249
            + VPG  +S    TL  + SN E+K R + +W   +P  +  Y++C+  Q   SP T + 
Sbjct  1197 VHVPGESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLS 1256
Query  1250 YKKILDSNPTNEFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVR- 1308
            Y + +D  P  +F+++I+ G+ C     + + G+++QS   K  V  + I+K C E+++ 
Sbjct  1257 YDEKMDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKR 1316
Query  1309 -NSV-KDCQKAAEMAKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEI 1366
             N + + CQKA  ++  L+E+D+++        SD  +    +G   +    N+ V  ++
Sbjct  1317 GNKILRTCQKAVVLSMLLDEVDISME-----VPSDALIALYSQGLFSLSEIDNLDVSLDV 1371
Query  1367 QEHSDVNDNDIRVQIKLSPNMTSAEGMASKSGQILTFSDIHI-DMGIDNDDEMNEIEKGI 1425
                +     I V+ KL+  +  A+ + +       F D+ + D G   +D ++  ++ +
Sbjct  1372 SNPKNAGKKKIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDL 1431
Query  1426 LHG-------ATCTLRNNEAETFDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPEN 1478
            L          +C L    A+TFDGK YPL+LG C H + TTYPR  P+  N+++ IP++
Sbjct  1432 LINNVFYEDETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKD 1491
Query  1479 MKVTVIAEETENNKKELQILLGNDEILF-KSSGTEVSAWVNGQKVKCSQKESYQHIKNDE 1537
              V+V++ E E  +KE+++LLG+D+I F   + ++   +VNG+K+  S+ ++YQ ++ +E
Sbjct  1492 KSVSVLSRENEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENE 1551
Query  1538 TLFEIFELPGPAIKLISDKYDIKLAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVT 1597
             +FEI+++    I L SDK+D+ LA D + V ++    Y+ SVRGLCG+FD  S NDFV 
Sbjct  1552 IIFEIYKMGDRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVG 1611
Query  1598 PKNCMLQKPEEFAATYIL-KERCEGPALNNAKKAERSKCIRKV-LRFSDVISDGEAGRPY 1655
            PKNC+++KPE F A+Y L   +CEG +LN AK  +   CIR+   +  +VISD E+GR  
Sbjct  1612 PKNCLFRKPEHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLD 1671
Query  1656 VNWKQWGYHKKENKKQCNTYRTQIITKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCL 1715
                 WGYH   NK +C  +RTQ+   DD ICFT+RPV +C+SGC +V TK K Y+++C+
Sbjct  1672 TEMSTWGYHHNVNK-HCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCM 1730
Query  1716 PKNDSSLGMKKRIEQGANPDLSQRTPTDNAMISVPLECVA 1755
             KN++++ +KKRIE+GANPDLSQ+  +    ++VP+ C A
Sbjct  1731 EKNEAAMKLKKRIEKGANPDLSQKPVSTTEELTVPFVCKA 1770

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.