The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC
CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD
CSKIESTIFRGYY
Sequence Info Allergen Name Length Opt Bits Score E Value
O04403 Par j 2 133 880 178.2 6.4e-47
P55958 Par j 2 133 785 159.9 2.1e-41
Q40905 Par j 1 138 468 98.9 5.1e-23
O04404 Par j 1 176 448 95.1 8.8e-22
P43217 Par j 1 139 352 76.6 2.7e-16
CAI94601 Par j 1.0103 139 350 76.2 3.5e-16
CAA54587 Par j 1.0101 133 332 72.7 3.8e-15
P19656-1 Zea m 14.0101 120 288 64.2 1.3e-12
P19656-2 Zea m 14.0102 128 284 63.4 2.2e-12
CAH69206 Tri tu 14.0101 115 256 58.0 8.7e-11
A0A059SSZ0 Pun g 1.0201 120 251 57.0 1.7e-10
A0A059STC4 Pun g 1.0101 120 243 55.5 5.1e-10
CAL07989 Pla a 3.0101 118 239 54.7 8.6e-10
AAL25839 Hev b 12 116 238 54.5 9.7e-10
NP_001316123 Sola l 7.0101 115 237 54.3 1.1e-09
ABY21307 Pla or 3.0101 118 235 54.0 1.5e-09
Q8VX12 Fra a 3.0101 117 234 53.8 1.7e-09
ACV04796 Api g 2 118 234 53.8 1.7e-09
Q0Z8V0 Rub i 3.0101 117 230 53.0 2.8e-09
AAA32970 Hor v 1 117 230 53.0 2.8e-09
19846220 Tri a 14.0101 90 227 52.3 3.5e-09
P82007 Hel a 3.0101 116 228 52.6 3.7e-09
ANC85020 Art ar 3.0102 116 225 52.0 5.5e-09
ACE07187 Art v 3.0202 116 225 52.0 5.5e-09
ANC85027 Art si 3.0102 116 225 52.0 5.5e-09
CAA42832 Hor v 1 134 225 52.1 6.1e-09
Q4PLT9 Fra a 3.0102 117 223 51.6 7.2e-09
A0A059ST23 Pun g 1.0301 120 221 51.3 9.6e-09
W0U0V5 Can s 3.0101 91 219 50.8 1e-08
ANC85025 Art la 3.0102 115 220 51.1 1.1e-08
EU564847 Art v 3.0301 117 219 50.9 1.2e-08
ANC85023 Art gm 3.0102 117 219 50.9 1.2e-08
ANC85021 Art ca 3.0101 117 218 50.7 1.4e-08
ANC85017 Art an 3.0101 117 218 50.7 1.4e-08
P85894 Mor n 3.0101 91 216 50.2 1.5e-08
P82534 Pru d 3 91 216 50.2 1.5e-08
Q4PLU0 Fra a 3.0201 117 217 50.5 1.6e-08
P81651 Pru ar 3 91 215 50.0 1.7e-08
P93224 Sola l 3.0101 114 216 50.3 1.8e-08
AAB42069 Lyc e 3 114 216 50.3 1.8e-08
ANC85026 Art si 3.0101 116 216 50.3 1.8e-08
ANC85022 Art gm 3.0101 117 216 50.3 1.8e-08
Q4PLT6 Fra a 3.0202 117 216 50.3 1.8e-08
A0AT29 Len c 3.0101 118 215 50.1 2.1e-08
ANC85018 Art an 3.0102 117 213 49.7 2.7e-08
Q9M5X8 Pru av 3 117 211 49.3 3.6e-08
EU564845 Art v 3.0201 114 210 49.1 4e-08
ANC85019 Art ar 3.0101 116 210 49.1 4.1e-08
ANC85024 Art la 3.0101 116 210 49.1 4.1e-08
ABX56711 Ara h 9.0101 116 208 48.8 5.3e-08
CAB96876 Pru p 3 91 206 48.3 5.8e-08
XP_019446786 Lup an 3.0101 116 207 48.6 6.1e-08
O04004 Amb a 6 118 207 48.6 6.1e-08
AAK28533 Cor a 8 115 205 48.2 7.9e-08
QIN55516 Art ca 3.0102 117 205 48.2 8e-08
ABX75045 Ara h 9.0201 92 203 47.7 8.7e-08
P81402 Pru p 3 91 201 47.3 1.1e-07
ACN11576 Pru du 3.0101 123 198 46.8 2.1e-07
A0A161AT60 Pis s 3.0101 120 195 46.3 3.1e-07
Q9M5X7 Mal d 3 115 191 45.5 5.1e-07
ADC80503 Pha v 3.0201 118 191 45.5 5.2e-07
ABU95411 Sin a 3.0101 92 189 45.0 5.6e-07
Q9M5X6 Pyr c 3 115 188 44.9 7.6e-07
ADC80502 Pha v 3.0101 115 184 44.1 1.3e-06
A0A510A9S3 Ara h 17.0101 93 174 42.1 4.2e-06
AAB46820 Par o 1.0101 24 130 33.1 0.00055
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 178.2 bits 880,  Expect = 6e-47
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
            MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC
Sbjct  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
Query  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD 120
            CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD
Sbjct  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD 120
Query  121  CSKIESTIFRGYY 133
            CSKIESTIFRGYY
Sbjct  121  CSKIESTIFRGYY 133

Sequence Alignment: 2. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 159.9 bits 785,  Expect = 2e-41
 Identities = 121/133 90%, Positives = 123/133 92%, Gaps = 0/133 0%
Query  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
            MRTVSMAALVVIAAALAWTSSAE A APAPGE  CGKVV+ IMPCL FVKGEEKEPSK C
Sbjct  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
Query  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD 120
            CSGTKKLSEEVKTTEQKREACKCIV ATKGISGIKNELVAEVPKKC I TTLPPITADFD
Sbjct  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD 120
Query  121  CSKIESTIFRGYY 133
            CSKI+STIFRGYY
Sbjct  121  CSKIQSTIFRGYY 133

Sequence Alignment: 3. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 98.9 bits 468,  Expect = 5e-23
 Identities = 73/131 55%, Positives = 91/131 69%, Gaps = 6/131 4%
Query  1    MRTVS----MAALVVIAAALAWTSSAELASAPAPG-EGPCGKVVHHIMPCLKFVKGEEKE 55
            MRTVS    +A +V++AA L WTSSA +A APAPG E  CG VV  +MPCL FV+G+EKE
Sbjct  1    MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE 60
Query  56   PSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTT-LPP 114
            PSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK CGI  + LPP
Sbjct  61   PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP 120
Query  115  ITADFDCSKIESTIFRG 131
            I  + DC  +    ++G
Sbjct  121  IDVNMDCKTLGVLHYKG 137

Sequence Alignment: 4. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 95.1 bits 448,  Expect = 9e-22
 Identities = 72/124 58%, Positives = 88/124 70%, Gaps = 7/124 5%
Query  1    MRTVS----MAALVVIAAALAWTSSAELAS-APAPG-EGPCGKVVHHIMPCLKFVKGEEK 54
            MRTVS    +A +V++AA LAWTS A +A  APAPG E  CG VV  +MPCL FV+G+EK
Sbjct  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
Query  55   EPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTT-LP 113
            EPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK CGI  + LP
Sbjct  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
Query  114  PITADFDCSKI 124
            PI  + DC  +
Sbjct  121  PIDVNMDCKTL 131

Sequence Alignment: 5. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 76.6 bits 352,  Expect = 3e-16
 Identities = 49/90 54%, Positives = 61/90 67%, Gaps = 1/90 1%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG +V  +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I
Sbjct  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
Query  95   KNELVAEVPKKCGITTT-LPPITADFDCSKI 124
              +LV+EVPK CGI  + LPPI  + DC  +
Sbjct  64   DGKLVSEVPKHCGIVDSKLPPIDVNMDCKTV 94

Sequence Alignment: 6. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 76.2 bits 350,  Expect = 4e-16
 Identities = 49/90 54%, Positives = 61/90 67%, Gaps = 1/90 1%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG +V  +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I
Sbjct  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
Query  95   KNELVAEVPKKCGITTT-LPPITADFDCSKI 124
              +LV+EVPK CGI  + LPPI  + DC  +
Sbjct  64   DGKLVSEVPKHCGIVDSKLPPIDVNMDCKTL 94

Sequence Alignment: 7. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 72.7 bits 332,  Expect = 4e-15
 Identities = 47/87 54%, Positives = 59/87 67%, Gaps = 1/87 1%
Query  38   VVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNE 97
            +V  +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +
Sbjct  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
Query  98   LVAEVPKKCGITTT-LPPITADFDCSKI 124
            LV+EVPK CGI  + LPPI  + DC  +
Sbjct  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTV 88

Sequence Alignment: 8. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 64.2 bits 288,  Expect = 1e-12
 Identities = 41/112 36%, Positives = 65/112 58%, Gaps = 5/112 4%
Query  9    LVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLS 68
            L V+A A+   +   LA+A +     CG+V   I PC+ + +G+   PS  CCSG + L+
Sbjct  7    LAVVATAV--VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
Query  69   EEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKI 124
               +TT  +R AC C+  A  G+SG+     A +P KCG++  +P  I+   DCS++
Sbjct  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS--IPYTISTSTDCSRV 119

Sequence Alignment: 9. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 63.4 bits 284,  Expect = 2e-12
 Identities = 41/111 36%, Positives = 64/111 57%, Gaps = 5/111 4%
Query  9    LVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLS 68
            L V+A A+   +   LA+A +     CG+V   I PC+ + +G+   PS  CCSG + L+
Sbjct  7    LAVVATAV--VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
Query  69   EEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSK 123
               +TT  +R AC C+  A  G+SG+     A +P KCG++  +P  I+   DCS+
Sbjct  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS--IPYTISTSTDCSR 118

Sequence Alignment: 10. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 58.0 bits 256,  Expect = 9e-11
 Identities = 40/109 36%, Positives = 63/109 57%, Gaps = 12/109 11%
Query  4    VSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSG 63
            V+   LV + AA+    +    S        CG+V   + PC+ + +G    PS +CCSG
Sbjct  6    VAQVVLVAVVAAMLLAVTEAAVS--------CGQVSSALSPCISYARGNGASPSAACCSG 57
Query  64   TKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSK 123
             + L+   ++T  K+ ACKCI +A  G++  K    A +P KCG++     I++  DCSK
Sbjct  58   VRSLASSARSTADKQAACKCIKSAAAGLNAGK---AAGIPTKCGVSVPYA-ISSSVDCSK 113
Query  124  I 124
            I
Sbjct  114  I 114

Sequence Alignment: 11. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 57.0 bits 251,  Expect = 2e-10
 Identities = 32/89 35%, Positives = 53/89 59%, Gaps = 3/89 3%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PC+ + +G    PS +CCSG + L+   KTT  ++ AC C+    + I+GI
Sbjct  31   CGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGI 90
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
                V  +P KCG+  ++P  I+   DCS+++
Sbjct  91   NYGRVGALPGKCGV--SIPYKISPSTDCSRVK 120

Sequence Alignment: 12. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 55.5 bits 243,  Expect = 5e-10
 Identities = 36/100 36%, Positives = 57/100 57%, Gaps = 5/100 5%
Query  24   LASAPAPGEGP--CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREAC 81
            L +AP   E    CG+V   + PC+ + +        +CCSG K L    +TT  ++  C
Sbjct  18   LVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATC 77
Query  82   KCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            KC+ +A+  ISGI   LVA +P KCG+   +P  I+   DC++++
Sbjct  78   KCLKSASTSISGINYGLVASLPAKCGV--NIPYKISPSTDCARVK 120

Sequence Alignment: 13. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 54.7 bits 239,  Expect = 9e-10
 Identities = 41/98 41%, Positives = 60/98 61%, Gaps = 7/98 7%
Query  24   LASAP-APGEGPCGKVVHHIMPCLKFVK-GEEKEPSKSCCSGTKKLSEEVKTTEQKREAC 81
            +A+AP A     CG VV  + PCL F++ G    P+  CC+G K L+ + KTT  ++ AC
Sbjct  18   VATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAAC 75
Query  82   KCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
             C+  A+  ISGI+    A +  KCG+   LP  I+   DCSK++
Sbjct  76   GCLKTASTSISGIQLGNAASLAGKCGV--NLPYKISPTIDCSKVK 118

Sequence Alignment: 14. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 54.5 bits 238,  Expect = 1e-09
 Identities = 32/100 32%, Positives = 58/100 58%, Gaps = 4/100 4%
Query  24   LASAPAPGEG-PCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACK 82
            L +AP   +   CG+V   ++PCL ++K     P  +CC+G + ++   KTT  +R AC+
Sbjct  15   LVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQ 74
Query  83   CIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            C+ +A   + G+    VA +P KCG+   +P  I+   +C+ ++
Sbjct  75   CLKSAAGSVKGLNPTTVAGLPGKCGV--NIPYKISLSTNCATVK 116

Sequence Alignment: 15. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 54.3 bits 237,  Expect = 1e-09
 Identities = 39/114 34%, Positives = 68/114 59%, Gaps = 10/114 8%
Query  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
            M+ +++  LVV+A         +LA   A G   CG+V  ++ PC+ F+  +  EP  +C
Sbjct  1    MKAIAILVLVVLAVF-------QLAMV-ARGAITCGQVDANLAPCVPFLT-QGGEPGAAC 51
Query  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD 120
            CSG + L+   ++++ +R AC C+ AA      +K++    +P KCGI+ T+P I+   +
Sbjct  52   CSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVP-ISRTVN 110
Query  121  CSKI 124
            C  I
Sbjct  111  CDTI 114

Sequence Alignment: 16. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 54.0 bits 235,  Expect = 1e-09
 Identities = 40/98 40%, Positives = 60/98 61%, Gaps = 7/98 7%
Query  24   LASAP-APGEGPCGKVVHHIMPCLKFVK-GEEKEPSKSCCSGTKKLSEEVKTTEQKREAC 81
            +A+AP A     CG VV  + PCL +++ G    P+  CC+G K L+ + KTT  ++ AC
Sbjct  18   VATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAAC 75
Query  82   KCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
             C+  A+  ISGI+    A +  KCG+   LP  I+   DCSK++
Sbjct  76   GCLKTASTSISGIQLGNAASLAGKCGV--NLPYKISPTIDCSKVK 118

Sequence Alignment: 17. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 53.8 bits 234,  Expect = 2e-09
 Identities = 40/109 36%, Positives = 62/109 56%, Gaps = 13/109 11%
Query  4    VSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSG 63
            +S+ AL+ I  AL           P      CG+V  +I PCL +VK     P+ +CCSG
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASNISPCLTYVKSGGAVPA-ACCSG 56
Query  64   TKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSK 123
             + L+   KTT  ++ AC C+  A  GI G+   L A +P KCG++     I+   +C+ 
Sbjct  57   IRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYK-ISTTTNCAA 115
Query  124  IE 125
            ++
Sbjct  116  VK 117

Sequence Alignment: 18. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 53.8 bits 234,  Expect = 2e-09
 Identities = 39/110 35%, Positives = 60/110 54%, Gaps = 5/110 4%
Query  12   IAAALAWTSSAELASAPAPGEG-PCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEE 70
            +A A+A      + + PA  EG  CG+V   +  CL ++KG    PS +CC G K L+  
Sbjct  6    VAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG-GYPSPACCGGVKGLNSL 64
Query  71   VKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKI 124
             KT   +++AC C+      + GI     + +P KCGI   +P PI+   DCS++
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIR--IPYPISPSTDCSRV 117

Sequence Alignment: 19. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 53.0 bits 230,  Expect = 3e-09
 Identities = 35/117 29%, Positives = 62/117 52%, Gaps = 3/117 2%
Query  6    MAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTK 65
            MA   V+  AL       +A  P      CG+V +++ PC+ +VK     P+ +CC+G +
Sbjct  1    MACSAVMKLALVALLCIVVA-VPVAQAITCGQVTQNVAPCFNYVKNGGAVPA-ACCNGVR 58
Query  66   KLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKIE 125
             L+ + KTT  +++ C C+  A   I G+   L A +P KCG++     I+   +C+ ++
Sbjct  59   NLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYK-ISTSTNCATVK 117

Sequence Alignment: 20. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 53.0 bits 230,  Expect = 3e-09
 Identities = 36/113 31%, Positives = 61/113 53%, Gaps = 5/113 4%
Query  7    AALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKK 66
            A ++++AAAL    +A   +A A     CG+V   + PCL +V+G    PS  CC+G + 
Sbjct  4    AQVLLMAAALVLMLTAAPRAAVALN---CGQVDSKMKPCLTYVQGGPG-PSGECCNGVRD 59
Query  67   LSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKI 124
            L  + +++  ++  C C+    +GI  +     A +P KC +      I+ D DCS+I
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYT-ISPDIDCSRI 116

Sequence Alignment: 21. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 52.3 bits 227,  Expect = 3e-09
 Identities = 30/87 34%, Positives = 48/87 55%, Gaps = 4/87 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG V   + PCL +V+G    PS  CC G K L  + ++   ++ AC C+    +GI  +
Sbjct  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKI 124
              +    +P KCG+   LP  I+ + DCS++
Sbjct  62   NEDNARSIPPKCGVN--LPYTISLNIDCSRV 90

Sequence Alignment: 22. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 52.6 bits 228,  Expect = 4e-09
 Identities = 36/107 33%, Positives = 61/107 57%, Gaps = 4/107 3%
Query  14   AALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKT 73
            A LA    A+L   P+     C  V  ++ PCL +++   K P+ +CC+G KKL    +T
Sbjct  9    AILAMIVMAQLMVHPSVAI-TCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGATRT 66
Query  74   TEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKI 124
               +R ACKC   A   +  ++ ++ + +P KCGI+T++P I  + +C+ I
Sbjct  67   QADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIP-INPNVNCNTI 115

Sequence Alignment: 23. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 52.0 bits 225,  Expect = 5e-09
 Identities = 31/88 35%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I PCL ++K   + P+  CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 86
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++ A +P KCG+   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 24. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 52.0 bits 225,  Expect = 5e-09
 Identities = 31/88 35%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I PCL ++K   + P+  CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 86
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++ A +P KCG+   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 25. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 52.0 bits 225,  Expect = 5e-09
 Identities = 31/88 35%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I PCL ++K   + P+  CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 86
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++ A +P KCG+   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 26. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 52.1 bits 225,  Expect = 6e-09
 Identities = 35/112 31%, Positives = 60/112 53%, Gaps = 5/112 4%
Query  7    AALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKK 66
            A ++++AAAL    +A   +A A     CG+V   + PCL +V+G    PS  CC+G + 
Sbjct  4    AQVLLMAAALVLMLTAAPRAAVALN---CGQVDSKMKPCLTYVQGGPG-PSGECCNGVRD 59
Query  67   LSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSK 123
            L  + +++  ++  C C+    +GI  +     A +P KC +      I+ D DCS+
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYT-ISPDIDCSR 115

Sequence Alignment: 27. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 51.6 bits 223,  Expect = 7e-09
 Identities = 38/109 34%, Positives = 60/109 55%, Gaps = 13/109 11%
Query  4    VSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSG 63
            +S+ AL+ I  AL           P      CG+V  +I PC+ +VK     P+  CCSG
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASNISPCVTYVKSGGAVPAP-CCSG 56
Query  64   TKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSK 123
             + L+   KTT  ++  C C+  A  GI G+   L A +P KCG++     I+   +C+ 
Sbjct  57   IRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYK-ISTTTNCAA 115
Query  124  IE 125
            ++
Sbjct  116  VK 117

Sequence Alignment: 28. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 51.3 bits 221,  Expect = 1e-08
 Identities = 33/100 33%, Positives = 56/100 56%, Gaps = 4/100 4%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEP-SKSCCSGTKKLSEEVKTTEQKREACK 82
            +AS  A     CG+V   +  C+++ +G    P  ++CC+G + L+   KTT  ++ AC+
Sbjct  19   VASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACR 78
Query  83   CIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            C+ +    ISGI   LVA  P KCG+  ++P  I    +C  ++
Sbjct  79   CLKSLASSISGINYGLVAGAPGKCGV--SIPYKIAPSTNCDNVK 120

Sequence Alignment: 29. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 50.8 bits 219,  Expect = 1e-08
 Identities = 32/88 36%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PCL ++K     P   CC+  K LS   KT   ++ ACKC+ +A   I G+
Sbjct  3    CGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGV 61
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
               L + +P KCG+  ++P  I+   DCS ++
Sbjct  62   NFNLASGLPGKCGV--SIPYKISPSTDCSSVK 91

Sequence Alignment: 30. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 51.1 bits 220,  Expect = 1e-08
 Identities = 33/97 34%, Positives = 57/97 58%, Gaps = 4/97 4%
Query  26   SAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIV 85
            S+ A     C  V   I PCL ++K   + P+  CC+G K L++  KTT  ++ AC C+ 
Sbjct  18   SSYAEAALTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLK 76
Query  86   AATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            A+ K    +K+++   +P KCG+   LP  ++ + DC+K++
Sbjct  77   ASFKSNKDLKSDFAVPLPSKCGLN--LPYKLSLETDCNKVK 115

Sequence Alignment: 31. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 50.9 bits 219,  Expect = 1e-08
 Identities = 31/88 35%, Positives = 54/88 61%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V   I PCL ++K   + P+  CC+G K L++  KTT  ++ AC C+ A+ K    +
Sbjct  29   CSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDL 87
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++   +P KCG+   LP  ++ + DC+K++
Sbjct  88   KSDFAVPLPSKCGL--NLPYKLSLETDCNKVK 117

Sequence Alignment: 32. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 50.9 bits 219,  Expect = 1e-08
 Identities = 33/99 33%, Positives = 58/99 58%, Gaps = 4/99 4%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKC 83
            ++S+ A     C  V + I PCL F+K   + P+  CC+G K L++  KTT  ++ AC C
Sbjct  18   VSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNC 76
Query  84   IVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +  + K    +K++    +P KCG+   +P  I+ + DC+K++
Sbjct  77   LKTSFKSNKDLKSDNAVVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 33. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 50.7 bits 218,  Expect = 1e-08
 Identities = 33/99 33%, Positives = 56/99 56%, Gaps = 4/99 4%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKC 83
            ++S+ A     C  V + I+PC  F+K +  E S  CC+G K L++  KTT  ++ AC C
Sbjct  18   VSSSYAEAALTCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLNDAAKTTPDRQAACNC 76
Query  84   IVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +    K     K++    +P KCG+   +P  I+ + DC+K++
Sbjct  77   LKTTFKSNKDFKSDNAVVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 34. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 50.7 bits 218,  Expect = 1e-08
 Identities = 33/99 33%, Positives = 56/99 56%, Gaps = 4/99 4%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKC 83
            ++S+ A     C  V + I+PC  F+K +  E S  CC+G K L++  KTT  ++ AC C
Sbjct  18   VSSSYAEAALTCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLNDAAKTTPDRQAACNC 76
Query  84   IVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +    K     K++    +P KCG+   +P  I+ + DC+K++
Sbjct  77   LKTTFKSNKDFKSDNAVVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 35. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 50.2 bits 216,  Expect = 2e-08
 Identities = 28/89 31%, Positives = 50/89 56%, Gaps = 2/89 2%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PC+ +++     P+ +CC+G + L+   KTT  ++ AC C+ +A   I G+
Sbjct  3    CGQVSSSLAPCINYLRAGGVVPA-NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGL 61
Query  95   KNELVAEVPKKCGITTTLPPITADFDCSKIE 125
               L A +P KCG++     I+   DC  ++
Sbjct  62   NLNLAAGLPGKCGVSVPYK-ISPSTDCKSVK 91

Sequence Alignment: 36. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 50.2 bits 216,  Expect = 2e-08
 Identities = 28/89 31%, Positives = 50/89 56%, Gaps = 2/89 2%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V  ++ PC+ +VKG    P  +CC+G + ++   +TT  +R AC C+   +  I G+
Sbjct  3    CGQVSSNLAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGV 61
Query  95   KNELVAEVPKKCGITTTLPPITADFDCSKIE 125
                 A +P KCG+      I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGVNVPYK-ISASTNCATVK 91

Sequence Alignment: 37. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 50.5 bits 217,  Expect = 2e-08
 Identities = 36/109 33%, Positives = 60/109 55%, Gaps = 13/109 11%
Query  4    VSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSG 63
            +S+ AL+ I  AL           P      CG+V   I PC+ +VK     P+ +CC+G
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASSISPCVNYVKSGGAVPA-ACCNG 56
Query  64   TKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSK 123
             + L+   KTT  ++  C C+  A+  I G+   L A +P KCG++     I+   +C+ 
Sbjct  57   IRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYK-ISTSTNCAA 115
Query  124  IE 125
            ++
Sbjct  116  VK 117

Sequence Alignment: 38. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 50.0 bits 215,  Expect = 2e-08
 Identities = 29/88 32%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PC+ +V+G    P  +CC+G + ++   +TT  +R AC C+   +  ISG+
Sbjct  3    CGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGV 61
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
                 A +P KCG+   +P  I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGV--NIPYKISASTNCATVK 91

Sequence Alignment: 39. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 50.3 bits 216,  Expect = 2e-08
 Identities = 34/95 35%, Positives = 50/95 52%, Gaps = 5/95 5%
Query  27   APAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVA 86
            AP      CG+V   + PCL +++G  + P   CC G K L    KT E ++ AC C+ +
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  87   ATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            A   I GI     A +P  CG+   +P  I+   DCS ++
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVN--IPYKISPSTDCSTVQ 114

Sequence Alignment: 40. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 50.3 bits 216,  Expect = 2e-08
 Identities = 34/95 35%, Positives = 50/95 52%, Gaps = 5/95 5%
Query  27   APAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVA 86
            AP      CG+V   + PCL +++G  + P   CC G K L    KT E ++ AC C+ +
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  87   ATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            A   I GI     A +P  CG+   +P  I+   DCS ++
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVN--IPYKISPSTDCSTVQ 114

Sequence Alignment: 41. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 50.3 bits 216,  Expect = 2e-08
 Identities = 30/88 34%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I PCL ++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKISPCLNYLKQGGEVPA-NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDL 86
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K++    +P KCG+  T+P  ++ + DC+K++
Sbjct  87   KSDYAVPLPSKCGV--TIPYKLSMETDCNKVK 116

Sequence Alignment: 42. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 50.3 bits 216,  Expect = 2e-08
 Identities = 33/99 33%, Positives = 57/99 57%, Gaps = 4/99 4%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKC 83
            ++S+ A     C  V + I PC  F+K   + P+  CC+G K L++  KTT  ++ AC C
Sbjct  18   VSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNC 76
Query  84   IVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +  + K     K++  A +P KCG+   +P  I+ + DC+K++
Sbjct  77   LKTSFKSNKDFKSDNAAVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 43. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 50.3 bits 216,  Expect = 2e-08
 Identities = 36/109 33%, Positives = 59/109 54%, Gaps = 13/109 11%
Query  4    VSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSG 63
            +S+ AL+ I  AL           P      CG+V   I PC+ +VK     P+ +CC+G
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASSISPCVNYVKSGGAVPA-ACCNG 56
Query  64   TKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSK 123
             + L+   KTT  ++  C C+  A+  I G+   L A +P KCG+      I+   +C+ 
Sbjct  57   IRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYK-ISTSTNCAA 115
Query  124  IE 125
            ++
Sbjct  116  VK 117

Sequence Alignment: 44. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 50.1 bits 215,  Expect = 2e-08
 Identities = 34/96 35%, Positives = 51/96 53%, Gaps = 5/96 5%
Query  27   AP-APGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIV 85
            AP A G   CG V   + PCL ++ G    PS  CC G KKL     TT  ++ AC C+ 
Sbjct  20   APMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLK 78
Query  86   AATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +A   I+ +     A +P KCG+   +P  I+   +C+ ++
Sbjct  79   SAAGSITKLNTNNAAALPGKCGVN--IPYKISTTTNCNTVK 117

Sequence Alignment: 45. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 49.7 bits 213,  Expect = 3e-08
 Identities = 33/99 33%, Positives = 54/99 54%, Gaps = 4/99 4%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKC 83
            + S+ A     C  V   I PC  F++   + P   CC+G K L++  KTT  ++ AC C
Sbjct  18   VTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPV-DCCTGVKGLNDAAKTTPDRQAACNC 76
Query  84   IVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +  + K  +  K E  A +P KCG+   +P  I+ + DC+K++
Sbjct  77   LKTSFKSSNNFKEENAAVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 46. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 49.3 bits 211,  Expect = 4e-08
 Identities = 27/100 27%, Positives = 52/100 52%, Gaps = 2/100 2%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKC 83
            + S P      CG+V  ++ PC+ +V+G    P  +CC+G + ++   KTT  ++ AC C
Sbjct  18   VVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACNC 76
Query  84   IVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKIE 125
            +   +  + G+     A +P KCG+      I+   +C+ ++
Sbjct  77   LKQLSASVPGVNANNAAALPGKCGVNVPYK-ISPSTNCATVK 117

Sequence Alignment: 47. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 49.1 bits 210,  Expect = 4e-08
 Identities = 30/88 34%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I  CL ++K   + P+  CC+G K L++  KTT  ++ AC C+    K     
Sbjct  26   CSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 84
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++ A +P KCG+   +P  I+ + DC+K++
Sbjct  85   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 114

Sequence Alignment: 48. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 49.1 bits 210,  Expect = 4e-08
 Identities = 30/88 34%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I  CL ++K   + P+  CC+G K L++  KTT  ++ AC C+    K     
Sbjct  28   CSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++ A +P KCG+   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 49. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 49.1 bits 210,  Expect = 4e-08
 Identities = 30/88 34%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            C  V + I  CL ++K   + P+  CC+G K L++  KTT  ++ AC C+    K     
Sbjct  28   CSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            K+++ A +P KCG+   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 50. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 48.8 bits 208,  Expect = 5e-08
 Identities = 32/98 32%, Positives = 55/98 56%, Gaps = 6/98 6%
Query  24   LASAPAPGEGPCGKVVHHIMPCLKFV-KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACK 82
            +  AP      CG+V   + PC+ F+ KG    P  +CCSG + L   ++TT  ++ AC 
Sbjct  16   MVGAPMVNAISCGQVNSALAPCIPFLTKG--GAPPPACCSGVRGLLGALRTTADRQAACN 73
Query  83   CIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            C+ AA   + G+     A +P +CG+  ++P  I+   +C+ I+
Sbjct  74   CLKAAAGSLRGLNQGNAAALPGRCGV--SIPYKISTSTNCATIK 115

Sequence Alignment: 51. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 48.3 bits 206,  Expect = 6e-08
 Identities = 26/88 29%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PC+ +V+G    P  +CC+G + ++   +TT  ++ AC C+   +  + G+
Sbjct  3    CGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
                 A +P KCG+  ++P  I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGV--SIPYKISASTNCATVK 91

Sequence Alignment: 52. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 48.6 bits 207,  Expect = 6e-08
 Identities = 36/115 31%, Positives = 59/115 51%, Gaps = 6/115 5%
Query  6    MAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTK 65
            MA +V +A A+       + SAP      CG+V  ++  CL +++     P+  CC+G K
Sbjct  1    MAGIVKLACAV--LICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAP-CCNGIK 57
Query  66   KLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKI 124
             +    KTT  +R AC C+ AA     G+       +P KCG+   +P  I+   +C+ I
Sbjct  58   NILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV--NIPYKISTSTNCASI 115
Query  125  E 125
            +
Sbjct  116  K 116

Sequence Alignment: 53. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 48.6 bits 207,  Expect = 6e-08
 Identities = 33/100 33%, Positives = 57/100 57%, Gaps = 9/100 9%
Query  16   LAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTE 75
            ++W  +  +A++P      C  V + + PC  F+ G+E  PSK+CC+G   L+   KT  
Sbjct  17   VSWRPTM-FAASPT-----CDTVQNILAPCAGFLTGQE--PSKACCTGVNNLNNSRKTKA 68
Query  76   QKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKI 124
             +   C CI   TK I+    + +  +  KCG+   +P +  ++DCSK+
Sbjct  69   DRVAVCNCIKELTKSIA-YDPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 54. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 48.2 bits 205,  Expect = 8e-08
 Identities = 34/113 30%, Positives = 64/113 56%, Gaps = 9/113 7%
Query  6    MAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGT 64
            M +L ++ A L       + +AP A     C ++  ++ PC+ ++K     P  SCC G 
Sbjct  1    MGSLKLVCAVLL----CMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPP-SCCKGV 55
Query  65   KKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSK 123
            + +++  +TT  ++ AC C+    KGI+G+   L A +P KCG+   +P  I+   +C+ 
Sbjct  56   RAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV--NIPYKISPSTNCNN 113
Query  124  IE 125
            ++
Sbjct  114  VK 115

Sequence Alignment: 55. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 48.2 bits 205,  Expect = 8e-08
 Identities = 31/97 31%, Positives = 54/97 55%, Gaps = 4/97 4%
Query  26   SAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIV 85
            S+ A     C  V + I PCL F+K   + P+  CC+G K L++  KT   +++AC C+ 
Sbjct  20   SSYAEAALTCSDVSNKITPCLSFLKQGGEVPA-DCCTGVKGLNDAAKTGPDRQKACNCLK 78
Query  86   AATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
               K    +K++    +P KCG+   +P  I+ + DC+ ++
Sbjct  79   TTFKSNKDLKSDNAVVLPSKCGVN--IPYKISLETDCNTVK 117

Sequence Alignment: 56. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 47.7 bits 203,  Expect = 9e-08
 Identities = 32/87 36%, Positives = 51/87 58%, Gaps = 6/87 6%
Query  35   CGKVVHHIMPCLKFV-KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISG 93
            CG+V   + PC+ F+ KG    PS  CCSG + L    KTT  ++ AC C+ AA   + G
Sbjct  3    CGQVNSALAPCITFLTKG--GVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  94   IKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +     A +P +CG+  ++P  I+   +C+ I+
Sbjct  61   LNQGNAAALPGRCGV--SIPYKISTSTNCATIK 91

Sequence Alignment: 57. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 47.3 bits 201,  Expect = 1e-07
 Identities = 26/88 29%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PC+ +V+G    P  +CC+G + ++   +TT  ++ AC C+   +  + G+
Sbjct  3    CGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
                 A +P KCG+   +P  I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGV--HIPYKISASTNCATVK 91

Sequence Alignment: 58. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 46.8 bits 198,  Expect = 2e-07
 Identities = 32/87 36%, Positives = 50/87 57%, Gaps = 8/87 9%
Query  35   CGKVVHHIMPCLKFV-KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGI-- 91
            CG+VV+++ PC+ +V  G    P  SCC+G + L    +TT  ++  C C+  A  GI  
Sbjct  33   CGQVVNNLTPCINYVANGGALNP--SCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPY 90
Query  92   SGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            +     L A +P KCG+   +P  I+   DC  I+
Sbjct  91   TNANAGLAAGLPGKCGV--NIPYKISPSTDCKTIK 123

Sequence Alignment: 59. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 46.3 bits 195,  Expect = 3e-07
 Identities = 35/112 31%, Positives = 61/112 54%, Gaps = 15/112 13%
Query  2    RTVSMA--ALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKE-PSK 58
            R++ +A  ALV+    +A  + A L+         CG V   + PC+ +++      P  
Sbjct  3    RSMKLACVALVICMVVIAPMAEAALS---------CGTVSADMAPCVTYLQAPNNASPPP 53
Query  59   SCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITA 117
             CC+G KKL     TT  ++ AC C+ +A   I  +     A +P KCG+  ++P  I+ 
Sbjct  54   PCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGV--SIPYKIST 111
Query  118  DFDCSKI 124
              +C+ +
Sbjct  112  STNCNTV 118

Sequence Alignment: 60. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 45.5 bits 191,  Expect = 5e-07
 Identities = 25/89 28%, Positives = 47/89 52%, Gaps = 2/89 2%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG+V   + PC+ +V+     P  +CC+G + ++   +TT  ++ AC C+      ISG+
Sbjct  27   CGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGV 85
Query  95   KNELVAEVPKKCGITTTLPPITADFDCSKIE 125
                 A +P KCG+      I+   +C+ ++
Sbjct  86   NPNNAAGLPGKCGVNVPYK-ISTSTNCATVK 115

Sequence Alignment: 61. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 45.5 bits 191,  Expect = 5e-07
 Identities = 31/97 31%, Positives = 51/97 52%, Gaps = 5/97 5%
Query  26   SAP-APGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCI 84
            +AP A     CG+V   +  C+ F+      P+ SCCSG + L+   KTT  ++  C C+
Sbjct  19   TAPTAHAAISCGQVTSSLASCIPFLTKGGPVPA-SCCSGVRSLNAAAKTTPDRQAVCNCL 77
Query  85   VAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
             +A   I G        +P KCG++  +P  I+   +C+ I+
Sbjct  78   KSAAGAIPGFNANNAGILPGKCGVS--IPYKISTSTNCATIK 117

Sequence Alignment: 62. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 45.0 bits 189,  Expect = 6e-07
 Identities = 25/87 28%, Positives = 46/87 52%, Gaps = 4/87 4%
Query  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
            CG V  ++  C+ ++      P K CC+G   L+   +TT  +++AC+C+V A      +
Sbjct  4    CGTVNSNLAACIGYLTQNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSL 62
Query  95   KNELVAEVPKKCGITTTLP-PITADFDCSKI 124
                 A +PK CG+   +P  I+   +C+ +
Sbjct  63   NAARAAALPKACGVN--IPYKISKSTNCNSV 91

Sequence Alignment: 63. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 44.9 bits 188,  Expect = 8e-07
 Identities = 32/115 27%, Positives = 57/115 49%, Gaps = 5/115 4%
Query  6    MAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTK 65
            MA+  VI  AL       ++ A A     C +V  ++ PC+ +V+     P  +CC+G K
Sbjct  1    MASSAVIKLALVVALCMAVSVAHAI---TCSQVSANLAPCINYVRSGGAVPP-ACCNGIK 56
Query  66   KLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKIE 125
             ++   KTT  ++ AC C+      +SG+       +P KCG+      I+   +C+ ++
Sbjct  57   TINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYK-ISTSTNCATVK 115

Sequence Alignment: 64. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 44.1 bits 184,  Expect = 1e-06
 Identities = 30/113 26%, Positives = 60/113 53%, Gaps = 12/113 10%
Query  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
            M +V  A +VV+   +    +A+  +        CG+V  +++PC+ F++     P+  C
Sbjct  1    MASVKFACVVVLCMVVVGAHTAQGMT--------CGQVQSNLVPCVTFLQNGGFVPA-GC 51
Query  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADF 119
            C+G + +    ++T  +R  C C+  A   + G+       +P KCG+   +P  I+   
Sbjct  52   CNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV--NIPYKISTST 109
Query  120  DCSKI 124
            +C+ I
Sbjct  110  NCASI 114

Sequence Alignment: 65. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 42.1 bits 174,  Expect = 4e-06
 Identities = 30/86 34%, Positives = 48/86 55%, Gaps = 9/86 10%
Query  35   CGKVVHHIMPCLKFVK--GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGI- 91
            C  V   I PC+ ++K  G    P   CCSG + ++   KTT  ++  C C+ +A   + 
Sbjct  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  92   SGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125
            S I     A +P KCG+  ++P  I+   +CS I+
Sbjct  61   SQINPNNAASLPGKCGV--SIPYKISTSINCSSIK 93

Sequence Alignment: 66. Allergen Name: Par o 1.0101 Sequence ID: AAB46820

 Score = 33.1 bits 130,  Expect = 0.0005
 Identities = 20/24 83%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  33   GPCGKVVHHIMPCLKFVKGEEKEP 56
            GP GKVVH IMP LKFVKGEE EP
Sbjct  1    GPXGKVVHIIMPPLKFVKGEESEP 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.