The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC
CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD
CSKIQSTIFRGYY
Sequence Info Allergen Name Length Opt Bits Score E Value
P55958 Par j 2 133 887 163.1 2.4e-42
O04403 Par j 2 133 785 145.4 5e-37
Q40905 Par j 1 138 471 91.0 1.2e-20
O04404 Par j 1 176 451 87.6 1.6e-19
P43217 Par j 1 139 346 69.3 4.1e-14
CAI94601 Par j 1.0103 139 344 69.0 5.2e-14
CAA54587 Par j 1.0101 133 318 64.5 1.1e-12
P19656-1 Zea m 14.0101 120 271 56.3 3e-10
P19656-2 Zea m 14.0102 128 267 55.6 5e-10
AAA32970 Hor v 1 117 247 52.1 5.2e-09
CAH69206 Tri tu 14.0101 115 243 51.4 8.3e-09
CAA42832 Hor v 1 134 242 51.3 1.1e-08
A0A059SSZ0 Pun g 1.0201 120 239 50.7 1.4e-08
A0A059STC4 Pun g 1.0101 120 232 49.5 3.2e-08
CAL07989 Pla a 3.0101 118 230 49.2 4e-08
AAL25839 Hev b 12 116 227 48.7 5.7e-08
Q8VX12 Fra a 3.0101 117 227 48.7 5.7e-08
ABY21307 Pla or 3.0101 118 226 48.5 6.5e-08
Q0Z8V0 Rub i 3.0101 117 224 48.1 8.2e-08
ACV04796 Api g 2 118 219 47.3 1.5e-07
NP_001316123 Sola l 7.0101 115 218 47.1 1.7e-07
Q4PLT9 Fra a 3.0102 117 218 47.1 1.7e-07
A0AT29 Len c 3.0101 118 218 47.1 1.7e-07
19846220 Tri a 14.0101 90 216 46.7 1.7e-07
ACE07187 Art v 3.0202 116 217 46.9 1.9e-07
ANC85020 Art ar 3.0102 116 217 46.9 1.9e-07
ANC85027 Art si 3.0102 116 217 46.9 1.9e-07
P82534 Pru d 3 91 211 45.8 3.2e-07
Q4PLT6 Fra a 3.0202 117 212 46.1 3.5e-07
Q4PLU0 Fra a 3.0201 117 212 46.1 3.5e-07
AAB42069 Lyc e 3 114 211 45.9 3.8e-07
P93224 Sola l 3.0101 114 211 45.9 3.8e-07
P81651 Pru ar 3 91 209 45.5 4.1e-07
P82007 Hel a 3.0101 116 210 45.7 4.4e-07
W0U0V5 Can s 3.0101 91 208 45.3 4.6e-07
P85894 Mor n 3.0101 91 207 45.1 5.2e-07
ANC85018 Art an 3.0102 117 207 45.2 6.3e-07
A0A059ST23 Pun g 1.0301 120 207 45.2 6.4e-07
ANC85026 Art si 3.0101 116 206 45.0 7.1e-07
ANC85023 Art gm 3.0102 117 206 45.0 7.1e-07
ANC85025 Art la 3.0102 115 205 44.8 7.9e-07
ANC85021 Art ca 3.0101 117 205 44.8 8e-07
EU564847 Art v 3.0301 117 205 44.8 8e-07
ANC85017 Art an 3.0101 117 205 44.8 8e-07
ANC85022 Art gm 3.0101 117 203 44.5 1e-06
O04004 Amb a 6 118 202 44.3 1.2e-06
CAB96876 Pru p 3 91 199 43.7 1.4e-06
EU564845 Art v 3.0201 114 200 44.0 1.4e-06
ANC85024 Art la 3.0101 116 200 44.0 1.5e-06
ANC85019 Art ar 3.0101 116 200 44.0 1.5e-06
Q9M5X8 Pru av 3 117 200 44.0 1.5e-06
AAK28533 Cor a 8 115 199 43.8 1.6e-06
P81402 Pru p 3 91 195 43.0 2.2e-06
A0A161AT60 Pis s 3.0101 120 196 43.3 2.4e-06
QIN55516 Art ca 3.0102 117 195 43.1 2.7e-06
ACN11576 Pru du 3.0101 123 194 43.0 3.1e-06
ABX56711 Ara h 9.0101 116 191 42.4 4.3e-06
ABX75045 Ara h 9.0201 92 189 42.0 4.5e-06
XP_019446786 Lup an 3.0101 116 188 41.9 6.1e-06
Q9M5X7 Mal d 3 115 183 41.0 1.1e-05
ADC80503 Pha v 3.0201 118 180 40.5 1.6e-05
ABU95411 Sin a 3.0101 92 178 40.1 1.7e-05
Q9M5X6 Pyr c 3 115 177 40.0 2.3e-05
ADC80502 Pha v 3.0101 115 173 39.3 3.7e-05
A0A510A9S3 Ara h 17.0101 93 167 38.2 6.4e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 163.1 bits 887,  Expect = 2e-42
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
            MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC
Sbjct  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
Query  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD 120
            CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD
Sbjct  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD 120
Query  121  CSKIQSTIFRGYY 133
            CSKIQSTIFRGYY
Sbjct  121  CSKIQSTIFRGYY 133

Sequence Alignment: 2. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 145.4 bits 785,  Expect = 5e-37
 Identities = 121/133 90%, Positives = 123/133 92%, Gaps = 0/133 0%
Query  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
            MRTVSMAALVVIAAALAWTSSAE A APAPGE  CGKVV+ IMPCL FVKGEEKEPSK C
Sbjct  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
Query  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD 120
            CSGTKKLSEEVKTTEQKREACKCIV ATKGISGIKNELVAEVPKKC I TTLPPITADFD
Sbjct  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFD 120
Query  121  CSKIQSTIFRGYY 133
            CSKI+STIFRGYY
Sbjct  121  CSKIESTIFRGYY 133

Sequence Alignment: 3. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 91.0 bits 471,  Expect = 1e-20
 Identities = 74/131 56%, Positives = 91/131 69%, Gaps = 6/131 4%
Query  1    MRTVS----MAALVVIAAALAWTSSAEPAPAPAPG-EEACGKVVQDIMPCLHFVKGEEKE 55
            MRTVS    +A +V++AA L WTSSA  APAPAPG EE CG VV  +MPCL FV+G+EKE
Sbjct  1    MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE 60
Query  56   PSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDI-KTTLPP 114
            PSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK C I  + LPP
Sbjct  61   PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP 120
Query  115  ITADFDCSKIQSTIFRG 131
            I  + DC  +    ++G
Sbjct  121  IDVNMDCKTLGVLHYKG 137

Sequence Alignment: 4. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 87.6 bits 451,  Expect = 2e-19
 Identities = 73/124 58%, Positives = 89/124 71%, Gaps = 7/124 5%
Query  1    MRTVS----MAALVVIAAALAWTSSAEPAP-APAPG-EEACGKVVQDIMPCLHFVKGEEK 54
            MRTVS    +A +V++AA LAWTS A  AP APAPG EE CG VV+ +MPCL FV+G+EK
Sbjct  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
Query  55   EPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDI-KTTLP 113
            EPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK C I  + LP
Sbjct  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
Query  114  PITADFDCSKI 124
            PI  + DC  +
Sbjct  121  PIDVNMDCKTL 131

Sequence Alignment: 5. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 69.3 bits 346,  Expect = 4e-14
 Identities = 49/93 52%, Positives = 63/93 67%, Gaps = 1/93 1%
Query  32   EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI 91
            +E CG +V+ +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  92   SGIKNELVAEVPKKCDI-KTTLPPITADFDCSKI 124
            S I  +LV+EVPK C I  + LPPI  + DC  +
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTV 94

Sequence Alignment: 6. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 69.0 bits 344,  Expect = 5e-14
 Identities = 49/93 52%, Positives = 63/93 67%, Gaps = 1/93 1%
Query  32   EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI 91
            +E CG +V+ +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  92   SGIKNELVAEVPKKCDI-KTTLPPITADFDCSKI 124
            S I  +LV+EVPK C I  + LPPI  + DC  +
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTL 94

Sequence Alignment: 7. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 64.5 bits 318,  Expect = 1e-12
 Identities = 46/87 52%, Positives = 59/87 67%, Gaps = 1/87 1%
Query  38   VVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNE 97
            +V+ +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +
Sbjct  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
Query  98   LVAEVPKKCDI-KTTLPPITADFDCSKI 124
            LV+EVPK C I  + LPPI  + DC  +
Sbjct  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTV 88

Sequence Alignment: 8. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 56.3 bits 271,  Expect = 3e-10
 Identities = 40/116 34%, Positives = 64/116 55%, Gaps = 8/116 6%
Query  2    RTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECC 61
            RT  +A +     AL   ++A    A +     CG+V   I PC+ + +G+   PS  CC
Sbjct  3    RTQQLAVVATAVVALVLLAAATSEAAIS-----CGQVASAIAPCISYARGQGSGPSAGCC 57
Query  62   SGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFD 120
            SG + L+   +TT  +R AC C+  A  G+SG+     A +P KC +  ++P  I+   D
Sbjct  58   SGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV--SIPYTISTSTD 115
Query  121  CSKI 124
            CS++
Sbjct  116  CSRV 119

Sequence Alignment: 9. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 55.6 bits 267,  Expect = 5e-10
 Identities = 40/115 34%, Positives = 63/115 54%, Gaps = 8/115 6%
Query  2    RTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECC 61
            RT  +A +     AL   ++A    A +     CG+V   I PC+ + +G+   PS  CC
Sbjct  3    RTQQLAVVATAVVALVLLAAATSEAAIS-----CGQVASAIAPCISYARGQGSGPSAGCC 57
Query  62   SGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFD 120
            SG + L+   +TT  +R AC C+  A  G+SG+     A +P KC +  ++P  I+   D
Sbjct  58   SGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV--SIPYTISTSTD 115
Query  121  CSK 123
            CS+
Sbjct  116  CSR 118

Sequence Alignment: 10. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 52.1 bits 247,  Expect = 5e-09
 Identities = 38/113 33%, Positives = 63/113 55%, Gaps = 5/113 4%
Query  7    AALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKK 66
            A ++++AAAL    +A P  A A     CG+V   + PCL +V+G    PS ECC+G + 
Sbjct  4    AQVLLMAAALVLMLTAAPRAAVALN---CGQVDSKMKPCLTYVQGGPG-PSGECCNGVRD 59
Query  67   LSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKI 124
            L  + +++  ++  C C+    +GI  +     A +P KC++      I+ D DCS+I
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYT-ISPDIDCSRI 116

Sequence Alignment: 11. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 51.4 bits 243,  Expect = 8e-09
 Identities = 40/114 35%, Positives = 66/114 57%, Gaps = 12/114 10%
Query  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
            M   ++A +V++A   A   +   A        +CG+V   + PC+ + +G    PS  C
Sbjct  1    MARSAVAQVVLVAVVAAMLLAVTEAAV------SCGQVSSALSPCISYARGNGASPSAAC 54
Query  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADF 119
            CSG + L+   ++T  K+ ACKCI  A  G++  K    A +P KC +  ++P  I++  
Sbjct  55   CSGVRSLASSARSTADKQAACKCIKSAAAGLNAGK---AAGIPTKCGV--SVPYAISSSV 109
Query  120  DCSKIQ 125
            DCSKI+
Sbjct  110  DCSKIR 115

Sequence Alignment: 12. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 51.3 bits 242,  Expect = 1e-08
 Identities = 37/112 33%, Positives = 62/112 55%, Gaps = 5/112 4%
Query  7    AALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKK 66
            A ++++AAAL    +A P  A A     CG+V   + PCL +V+G    PS ECC+G + 
Sbjct  4    AQVLLMAAALVLMLTAAPRAAVALN---CGQVDSKMKPCLTYVQGGPG-PSGECCNGVRD 59
Query  67   LSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSK 123
            L  + +++  ++  C C+    +GI  +     A +P KC++      I+ D DCS+
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYT-ISPDIDCSR 115

Sequence Alignment: 13. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 50.7 bits 239,  Expect = 1e-08
 Identities = 31/89 34%, Positives = 51/89 57%, Gaps = 3/89 3%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PC+ + +G    PS  CCSG + L+   KTT  ++ AC C+    + I+GI
Sbjct  31   CGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGI 90
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
                V  +P KC +  ++P  I+   DCS+++
Sbjct  91   NYGRVGALPGKCGV--SIPYKISPSTDCSRVK 120

Sequence Alignment: 14. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 49.5 bits 232,  Expect = 3e-08
 Identities = 33/99 33%, Positives = 51/99 51%, Gaps = 3/99 3%
Query  25   APAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCI 84
            AP        CG+V   + PC+ + +         CCSG K L    +TT  ++  CKC+
Sbjct  21   APIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCL 80
Query  85   VRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
              A+  ISGI   LVA +P KC +   +P  I+   DC++++
Sbjct  81   KSASTSISGINYGLVASLPAKCGV--NIPYKISPSTDCARVK 120

Sequence Alignment: 15. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 49.2 bits 230,  Expect = 4e-08
 Identities = 41/95 43%, Positives = 58/95 61%, Gaps = 9/95 9%
Query  27   APAPGEEA---CGKVVQDIMPCLHFVK-GEEKEPSKECCSGTKKLSEEVKTTEQKREACK 82
            A AP  EA   CG VV  + PCL F++ G    P+  CC+G K L+ + KTT  ++ AC 
Sbjct  19   ATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACG 76
Query  83   CIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            C+  A+  ISGI+    A +  KC +   LP  I+   DCSK++
Sbjct  77   CLKTASTSISGIQLGNAASLAGKCGVN--LPYKISPTIDCSKVK 118

Sequence Alignment: 16. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 48.7 bits 227,  Expect = 6e-08
 Identities = 36/115 31%, Positives = 62/115 53%, Gaps = 6/115 5%
Query  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTK 65
            MAAL +++  +     A P  A A     CG+V   ++PCL ++K     P   CC+G +
Sbjct  1    MAALKMVSFLVLCMLVAAPMTAQAI---TCGQVQSALVPCLSYLKTTGPTPPATCCNGVR 57
Query  66   KLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKI 124
             ++   KTT  +R AC+C+  A   + G+    VA +P KC +   +P  I+   +C+ +
Sbjct  58   TINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV--NIPYKISLSTNCATV 115
Query  125  Q 125
            +
Sbjct  116  K 116

Sequence Alignment: 17. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 48.7 bits 227,  Expect = 6e-08
 Identities = 40/108 37%, Positives = 63/108 58%, Gaps = 15/108 13%
Query  4    VSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSG 63
            +S+ AL+ I  AL           P      CG+V  +I PCL +VK     P+  CCSG
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASNISPCLTYVKSGGAVPAA-CCSG 56
Query  64   TKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCS 122
             + L+   KTT  ++ AC C+ +A  GI G+   L A +P KC +  ++P  I+   +C+
Sbjct  57   IRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGV--SVPYKISTTTNCA 114
Query  123  KIQ 125
             ++
Sbjct  115  AVK 117

Sequence Alignment: 18. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 48.5 bits 226,  Expect = 6e-08
 Identities = 40/95 42%, Positives = 58/95 61%, Gaps = 9/95 9%
Query  27   APAPGEEA---CGKVVQDIMPCLHFVK-GEEKEPSKECCSGTKKLSEEVKTTEQKREACK 82
            A AP  EA   CG VV  + PCL +++ G    P+  CC+G K L+ + KTT  ++ AC 
Sbjct  19   ATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACG 76
Query  83   CIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            C+  A+  ISGI+    A +  KC +   LP  I+   DCSK++
Sbjct  77   CLKTASTSISGIQLGNAASLAGKCGVN--LPYKISPTIDCSKVK 118

Sequence Alignment: 19. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 48.1 bits 224,  Expect = 8e-08
 Identities = 30/95 31%, Positives = 55/95 57%, Gaps = 4/95 4%
Query  28   PAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRA 87
            P      CG+V Q++ PC+++VK     P+  CC+G + L+ + KTT  +++ C C+  A
Sbjct  22   PVAQAITCGQVTQNVAPCFNYVKNGGAVPAA-CCNGVRNLNSQAKTTADRQQTCNCLKNA 80
Query  88   TKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
               I G+   L A +P KC +  ++P  I+   +C+ ++
Sbjct  81   AGSIPGLNPSLAAGLPGKCGV--SVPYKISTSTNCATVK 117

Sequence Alignment: 20. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 47.3 bits 219,  Expect = 2e-07
 Identities = 38/111 34%, Positives = 56/111 50%, Gaps = 5/111 4%
Query  10   VVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSE 69
            V IA A+         PA   G   CG+V   +  CL ++KG    PS  CC G K L+ 
Sbjct  6    VAIAVAVMLMVVVINHPAVVEGL-TCGQVTGKLGGCLGYLKGG-GYPSPACCGGVKGLNS 63
Query  70   EVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKI 124
              KT   +++AC C+      + GI     + +P KC I+  +P PI+   DCS++
Sbjct  64   LAKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIR--IPYPISPSTDCSRV 117

Sequence Alignment: 21. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 47.1 bits 218,  Expect = 2e-07
 Identities = 37/113 32%, Positives = 63/113 55%, Gaps = 12/113 10%
Query  1    MRTVSMAALVVIAA-ALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKE 59
            M+ +++  LVV+A   LA           A G   CG+V  ++ PC+ F+  +  EP   
Sbjct  1    MKAIAILVLVVLAVFQLAMV---------ARGAITCGQVDANLAPCVPFLT-QGGEPGAA 50
Query  60   CCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADF 119
            CCSG + L+   ++++ +R AC C+  A      +K++    +P KC I  T+P I+   
Sbjct  51   CCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVP-ISRTV 109
Query  120  DCSKI 124
            +C  I
Sbjct  110  NCDTI 114

Sequence Alignment: 22. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 47.1 bits 218,  Expect = 2e-07
 Identities = 38/108 35%, Positives = 62/108 57%, Gaps = 15/108 13%
Query  4    VSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSG 63
            +S+ AL+ I  AL           P      CG+V  +I PC+ +VK     P+  CCSG
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASNISPCVTYVKSGGAVPAP-CCSG 56
Query  64   TKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCS 122
             + L+   KTT  ++  C C+ +A  GI G+   L A +P KC +  ++P  I+   +C+
Sbjct  57   IRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGV--SVPYKISTTTNCA 114
Query  123  KIQ 125
             ++
Sbjct  115  AVK 117

Sequence Alignment: 23. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 47.1 bits 218,  Expect = 2e-07
 Identities = 34/96 35%, Positives = 52/96 54%, Gaps = 5/96 5%
Query  27   AP-APGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIV 85
            AP A G  +CG V  D+ PCL ++ G    PS +CC G KKL     TT  ++ AC C+ 
Sbjct  20   APMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLK 78
Query  86   RATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
             A   I+ +     A +P KC +   +P  I+   +C+ ++
Sbjct  79   SAAGSITKLNTNNAAALPGKCGVN--IPYKISTTTNCNTVK 117

Sequence Alignment: 24. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 46.7 bits 216,  Expect = 2e-07
 Identities = 29/87 33%, Positives = 48/87 55%, Gaps = 4/87 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG V   + PCL +V+G    PS +CC G K L  + ++   ++ AC C+    +GI  +
Sbjct  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKI 124
              +    +P KC +   LP  I+ + DCS++
Sbjct  62   NEDNARSIPPKCGVN--LPYTISLNIDCSRV 90

Sequence Alignment: 25. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 46.9 bits 217,  Expect = 2e-07
 Identities = 30/88 34%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL+++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 86
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++ A +P KC +   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 26. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 46.9 bits 217,  Expect = 2e-07
 Identities = 30/88 34%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL+++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 86
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++ A +P KC +   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 27. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 46.9 bits 217,  Expect = 2e-07
 Identities = 30/88 34%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL+++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 86
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++ A +P KC +   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 28. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 45.8 bits 211,  Expect = 3e-07
 Identities = 27/89 30%, Positives = 50/89 56%, Gaps = 2/89 2%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V  ++ PC+++VKG    P   CC+G + ++   +TT  +R AC C+ + +  I G+
Sbjct  3    CGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGV 61
Query  95   KNELVAEVPKKCDIKTTLPPITADFDCSKIQ 125
                 A +P KC +      I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGVNVPYK-ISASTNCATVK 91

Sequence Alignment: 29. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 46.1 bits 212,  Expect = 3e-07
 Identities = 35/109 32%, Positives = 59/109 54%, Gaps = 13/109 11%
Query  4    VSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSG 63
            +S+ AL+ I  AL           P      CG+V   I PC+++VK     P+  CC+G
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASSISPCVNYVKSGGAVPAA-CCNG 56
Query  64   TKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSK 123
             + L+   KTT  ++  C C+ +A+  I G+   L A +P KC +      I+   +C+ 
Sbjct  57   IRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYK-ISTSTNCAA 115
Query  124  IQ 125
            ++
Sbjct  116  VK 117

Sequence Alignment: 30. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 46.1 bits 212,  Expect = 3e-07
 Identities = 36/108 33%, Positives = 62/108 57%, Gaps = 15/108 13%
Query  4    VSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSG 63
            +S+ AL+ I  AL           P      CG+V   I PC+++VK     P+  CC+G
Sbjct  9    LSLVALLCIVVAL-----------PIAQAITCGQVASSISPCVNYVKSGGAVPAA-CCNG 56
Query  64   TKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCS 122
             + L+   KTT  ++  C C+ +A+  I G+   L A +P KC +  ++P  I+   +C+
Sbjct  57   IRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGV--SVPYKISTSTNCA 114
Query  123  KIQ 125
             ++
Sbjct  115  AVK 117

Sequence Alignment: 31. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 45.9 bits 211,  Expect = 4e-07
 Identities = 34/95 35%, Positives = 49/95 51%, Gaps = 5/95 5%
Query  27   APAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVR 86
            AP     +CG+V   + PCL +++G  + P   CC G K L    KT E ++ AC C+  
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  87   ATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            A   I GI     A +P  C +   +P  I+   DCS +Q
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVN--IPYKISPSTDCSTVQ 114

Sequence Alignment: 32. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 45.9 bits 211,  Expect = 4e-07
 Identities = 34/95 35%, Positives = 49/95 51%, Gaps = 5/95 5%
Query  27   APAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVR 86
            AP     +CG+V   + PCL +++G  + P   CC G K L    KT E ++ AC C+  
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  87   ATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            A   I GI     A +P  C +   +P  I+   DCS +Q
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVN--IPYKISPSTDCSTVQ 114

Sequence Alignment: 33. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 45.5 bits 209,  Expect = 4e-07
 Identities = 28/88 31%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PC+ +V+G    P   CC+G + ++   +TT  +R AC C+ + +  ISG+
Sbjct  3    CGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGV 61
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
                 A +P KC +   +P  I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGV--NIPYKISASTNCATVK 91

Sequence Alignment: 34. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 45.7 bits 210,  Expect = 4e-07
 Identities = 35/115 30%, Positives = 61/115 53%, Gaps = 9/115 7%
Query  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
            M+  SM   ++    +A      P+ A       C  V  ++ PCL +++   K P+  C
Sbjct  1    MKGTSMGVAILAMIVMAQLM-VHPSVAIT-----CNDVTGNLTPCLPYLRSGGK-PTPAC 53
Query  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD 120
            C+G KKL    +T   +R ACKC   A   +  ++ ++ + +P KC I T++P I  + +
Sbjct  54   CAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIP-INPNVN 111
Query  121  CSKI 124
            C+ I
Sbjct  112  CNTI 115

Sequence Alignment: 35. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 45.3 bits 208,  Expect = 5e-07
 Identities = 31/88 35%, Positives = 48/88 54%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PCL ++K     P   CC+  K LS   KT   ++ ACKC+  A   I G+
Sbjct  3    CGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGV 61
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
               L + +P KC +  ++P  I+   DCS ++
Sbjct  62   NFNLASGLPGKCGV--SIPYKISPSTDCSSVK 91

Sequence Alignment: 36. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 45.1 bits 207,  Expect = 5e-07
 Identities = 28/88 31%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PC+++++     P+  CC+G + L+   KTT  ++ AC C+  A   I G+
Sbjct  3    CGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGL 61
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
               L A +P KC +  ++P  I+   DC  ++
Sbjct  62   NLNLAAGLPGKCGV--SVPYKISPSTDCKSVK 91

Sequence Alignment: 37. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 45.2 bits 207,  Expect = 6e-07
 Identities = 36/111 32%, Positives = 60/111 54%, Gaps = 10/111 9%
Query  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTK 65
            M  + V+   +  TSS   A         C  V + I PC  F++   + P  +CC+G K
Sbjct  6    MKVFCVMVVCMVVTSSYAEAAL------TCNDVTKKISPCTSFLEKGGEVPV-DCCTGVK 58
Query  66   KLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKI 124
             L++  KTT  ++ AC C+  + K  +  K E  A +P KC +   +P  I+ + DC+K+
Sbjct  59   GLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGV--NIPYKISLETDCNKV 116
Query  125  Q 125
            +
Sbjct  117  K 117

Sequence Alignment: 38. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 45.2 bits 207,  Expect = 6e-07
 Identities = 35/110 31%, Positives = 62/110 56%, Gaps = 12/110 10%
Query  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEP-SKECCSGT 64
            +A +V++  A+A ++ AE           CG+V   +  C+++ +G    P  + CC+G 
Sbjct  9    LAGFVLVCMAVA-STVAEAGIT-------CGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
Query  65   KKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSK 123
            + L+   KTT  ++ AC+C+      ISGI   LVA  P KC +  ++P  I    +C  
Sbjct  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGV--SIPYKIAPSTNCDN 118
Query  124  IQ 125
            ++
Sbjct  119  VK 120

Sequence Alignment: 39. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 45.0 bits 206,  Expect = 7e-07
 Identities = 29/88 32%, Positives = 53/88 60%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL+++K   + P+  CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  28   CSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDL 86
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K++    +P KC +  T+P  ++ + DC+K++
Sbjct  87   KSDYAVPLPSKCGV--TIPYKLSMETDCNKVK 116

Sequence Alignment: 40. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 45.0 bits 206,  Expect = 7e-07
 Identities = 30/88 34%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL F+K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  29   CSDVSNKISPCLSFLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDL 87
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K++    +P KC +   +P  I+ + DC+K++
Sbjct  88   KSDNAVVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 41. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 44.8 bits 205,  Expect = 8e-07
 Identities = 29/88 32%, Positives = 53/88 60%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL ++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  27   CSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDL 85
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++   +P KC +   LP  ++ + DC+K++
Sbjct  86   KSDFAVPLPSKCGL--NLPYKLSLETDCNKVK 115

Sequence Alignment: 42. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 44.8 bits 205,  Expect = 8e-07
 Identities = 30/88 34%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I+PC  F+K +  E S +CC+G K L++  KTT  ++ AC C+    K     
Sbjct  29   CSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDF 87
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K++    +P KC +   +P  I+ + DC+K++
Sbjct  88   KSDNAVVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 43. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 44.8 bits 205,  Expect = 8e-07
 Identities = 29/88 32%, Positives = 53/88 60%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PCL ++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  29   CSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDL 87
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++   +P KC +   LP  ++ + DC+K++
Sbjct  88   KSDFAVPLPSKCGL--NLPYKLSLETDCNKVK 117

Sequence Alignment: 44. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 44.8 bits 205,  Expect = 8e-07
 Identities = 30/88 34%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I+PC  F+K +  E S +CC+G K L++  KTT  ++ AC C+    K     
Sbjct  29   CSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDF 87
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K++    +P KC +   +P  I+ + DC+K++
Sbjct  88   KSDNAVVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 45. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 44.5 bits 203,  Expect = 1e-06
 Identities = 30/88 34%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I PC  F+K   + P+ +CC+G K L++  KTT  ++ AC C+  + K     
Sbjct  29   CSDVSNKISPCTSFLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDF 87
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K++  A +P KC +   +P  I+ + DC+K++
Sbjct  88   KSDNAAVLPSKCGV--NIPYKISLETDCNKVK 117

Sequence Alignment: 46. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 44.3 bits 202,  Expect = 1e-06
 Identities = 33/95 34%, Positives = 50/95 52%, Gaps = 5/95 5%
Query  26   PAPAPGEEACGKVVQDIM-PCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCI 84
            P        C   VQ+I+ PC  F+ G+E  PSK CC+G   L+   KT   +   C CI
Sbjct  21   PTMFAASPTCD-TVQNILAPCAGFLTGQE--PSKACCTGVNNLNNSRKTKADRVAVCNCI 77
Query  85   VRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKI 124
               TK I+    + +  +  KC +K  +P +  ++DCSK+
Sbjct  78   KELTKSIA-YDPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 47. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 43.7 bits 199,  Expect = 1e-06
 Identities = 25/88 28%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PC+ +V+G    P   CC+G + ++   +TT  ++ AC C+ + +  + G+
Sbjct  3    CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
                 A +P KC +  ++P  I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGV--SIPYKISASTNCATVK 91

Sequence Alignment: 48. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 44.0 bits 200,  Expect = 1e-06
 Identities = 29/88 32%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I  CL ++K   + P+ +CC+G K L++  KTT  ++ AC C+    K     
Sbjct  26   CSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 84
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++ A +P KC +   +P  I+ + DC+K++
Sbjct  85   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 114

Sequence Alignment: 49. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 44.0 bits 200,  Expect = 1e-06
 Identities = 29/88 32%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I  CL ++K   + P+ +CC+G K L++  KTT  ++ AC C+    K     
Sbjct  28   CSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++ A +P KC +   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 50. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 44.0 bits 200,  Expect = 1e-06
 Identities = 29/88 32%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            C  V   I  CL ++K   + P+ +CC+G K L++  KTT  ++ AC C+    K     
Sbjct  28   CSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            K+++ A +P KC +   +P  I+ + DC+K++
Sbjct  87   KSDFAASLPSKCGV--NIPYKISLETDCNKVK 116

Sequence Alignment: 51. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 44.0 bits 200,  Expect = 1e-06
 Identities = 25/96 26%, Positives = 49/96 51%, Gaps = 2/96 2%
Query  28   PAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRA 87
            P      CG+V  ++ PC+ +V+G    P   CC+G + ++   KTT  ++ AC C+ + 
Sbjct  22   PIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQL 80
Query  88   TKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQ 125
            +  + G+     A +P KC +      I+   +C+ ++
Sbjct  81   SASVPGVNANNAAALPGKCGVNVPYK-ISPSTNCATVK 117

Sequence Alignment: 52. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 43.8 bits 199,  Expect = 2e-06
 Identities = 34/113 30%, Positives = 62/113 54%, Gaps = 9/113 7%
Query  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK-GEEKEPSKECCSGT 64
            M +L ++ A L     A P    A     C ++  ++ PC+ ++K G    PS  CC G 
Sbjct  1    MGSLKLVCAVLLCMMVAAPV---ARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGV 55
Query  65   KKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSK 123
            + +++  +TT  ++ AC C+    KGI+G+   L A +P KC +   +P  I+   +C+ 
Sbjct  56   RAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV--NIPYKISPSTNCNN 113
Query  124  IQ 125
            ++
Sbjct  114  VK 115

Sequence Alignment: 53. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 43.0 bits 195,  Expect = 2e-06
 Identities = 25/88 28%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PC+ +V+G    P   CC+G + ++   +TT  ++ AC C+ + +  + G+
Sbjct  3    CGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
Query  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
                 A +P KC +   +P  I+A  +C+ ++
Sbjct  62   NPNNAAALPGKCGVH--IPYKISASTNCATVK 91

Sequence Alignment: 54. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 43.3 bits 196,  Expect = 2e-06
 Identities = 31/95 32%, Positives = 50/95 52%, Gaps = 7/95 7%
Query  29   APGEEA---CGKVVQDIMPCLHFVKGEEKE-PSKECCSGTKKLSEEVKTTEQKREACKCI 84
            AP  EA   CG V  D+ PC+ +++      P   CC+G KKL     TT  ++ AC C+
Sbjct  20   APMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCL 79
Query  85   VRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
              A   I  +     A +P KC +  ++P  I+   +C+ ++
Sbjct  80   KSAAGSIPKLNTNNAAALPGKCGV--SIPYKISTSTNCNTVR 119

Sequence Alignment: 55. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 43.1 bits 195,  Expect = 3e-06
 Identities = 34/106 32%, Positives = 59/106 55%, Gaps = 11/106 10%
Query  10   VVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSE 69
            V+I   +  +S AE A         C  V   I PCL F+K   + P+ +CC+G K L++
Sbjct  11   VMIVCMVVLSSYAEAA-------LTCSDVSNKITPCLSFLKQGGEVPA-DCCTGVKGLND 62
Query  70   EVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
              KT   +++AC C+    K    +K++    +P KC +   +P  I+ + DC+ ++
Sbjct  63   AAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGV--NIPYKISLETDCNTVK 117

Sequence Alignment: 56. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 43.0 bits 194,  Expect = 3e-06
 Identities = 31/88 35%, Positives = 51/88 57%, Gaps = 8/88 9%
Query  34   ACGKVVQDIMPCLHFV-KGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI- 91
            +CG+VV ++ PC+++V  G    PS  CC+G + L    +TT  ++  C C+ +A  GI 
Sbjct  32   SCGQVVNNLTPCINYVANGGALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIP 89
Query  92   -SGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
             +     L A +P KC +   +P  I+   DC  I+
Sbjct  90   YTNANAGLAAGLPGKCGV--NIPYKISPSTDCKTIK 123

Sequence Alignment: 57. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 42.4 bits 191,  Expect = 4e-06
 Identities = 30/95 31%, Positives = 53/95 55%, Gaps = 6/95 6%
Query  27   APAPGEEACGKVVQDIMPCLHFV-KGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIV 85
            AP     +CG+V   + PC+ F+ KG    P+  CCSG + L   ++TT  ++ AC C+ 
Sbjct  19   APMVNAISCGQVNSALAPCIPFLTKGGAPPPA--CCSGVRGLLGALRTTADRQAACNCLK 76
Query  86   RATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
             A   + G+     A +P +C +  ++P  I+   +C+ I+
Sbjct  77   AAAGSLRGLNQGNAAALPGRCGV--SIPYKISTSTNCATIK 115

Sequence Alignment: 58. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 42.0 bits 189,  Expect = 5e-06
 Identities = 30/88 34%, Positives = 50/88 56%, Gaps = 6/88 6%
Query  34   ACGKVVQDIMPCLHFV-KGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGIS 92
            +CG+V   + PC+ F+ KG    PS  CCSG + L    KTT  ++ AC C+  A   + 
Sbjct  2    SCGQVNSALAPCITFLTKG--GVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
Query  93   GIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            G+     A +P +C +  ++P  I+   +C+ I+
Sbjct  60   GLNQGNAAALPGRCGV--SIPYKISTSTNCATIK 91

Sequence Alignment: 59. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 41.9 bits 188,  Expect = 6e-06
 Identities = 33/115 28%, Positives = 56/115 48%, Gaps = 6/115 5%
Query  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTK 65
            MA +V +A A+          AP      CG+V  ++  CL++++     P+  CC+G K
Sbjct  1    MAGIVKLACAVLICMVV--VSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAP-CCNGIK 57
Query  66   KLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKI 124
             +    KTT  +R AC C+  A     G+       +P KC +   +P  I+   +C+ I
Sbjct  58   NILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV--NIPYKISTSTNCASI 115
Query  125  Q 125
            +
Sbjct  116  K 116

Sequence Alignment: 60. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 41.0 bits 183,  Expect = 1e-05
 Identities = 24/89 26%, Positives = 45/89 50%, Gaps = 2/89 2%
Query  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
            CG+V   + PC+ +V+     P   CC+G + ++   +TT  ++ AC C+      ISG+
Sbjct  27   CGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGV 85
Query  95   KNELVAEVPKKCDIKTTLPPITADFDCSKIQ 125
                 A +P KC +      I+   +C+ ++
Sbjct  86   NPNNAAGLPGKCGVNVPYK-ISTSTNCATVK 115

Sequence Alignment: 61. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 40.5 bits 180,  Expect = 2e-05
 Identities = 34/116 29%, Positives = 58/116 50%, Gaps = 10/116 8%
Query  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
            M T++ A +V +   +  T     AP  A    +CG+V   +  C+ F+      P+  C
Sbjct  1    MATLNSACVVAVLCLVVLT-----APT-AHAAISCGQVTSSLASCIPFLTKGGPVPAS-C 53
Query  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADF 119
            CSG + L+   KTT  ++  C C+  A   I G        +P KC +  ++P  I+   
Sbjct  54   CSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGV--SIPYKISTST 111
Query  120  DCSKIQ 125
            +C+ I+
Sbjct  112  NCATIK 117

Sequence Alignment: 62. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 40.1 bits 178,  Expect = 2e-05
 Identities = 24/89 26%, Positives = 47/89 52%, Gaps = 4/89 4%
Query  34   ACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISG 93
            +CG V  ++  C+ ++      P K CC+G   L+   +TT  +++AC+C+V A      
Sbjct  3    SCGTVNSNLAACIGYLTQNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  94   IKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            +     A +PK C +   +P  I+   +C+ ++
Sbjct  62   LNAARAAALPKACGV--NIPYKISKSTNCNSVR 92

Sequence Alignment: 63. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 40.0 bits 177,  Expect = 2e-05
 Identities = 31/115 26%, Positives = 55/115 47%, Gaps = 5/115 4%
Query  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTK 65
            MA+  VI  AL        + A A     C +V  ++ PC+++V+     P   CC+G K
Sbjct  1    MASSAVIKLALVVALCMAVSVAHAI---TCSQVSANLAPCINYVRSGGAVPPA-CCNGIK 56
Query  66   KLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQ 125
             ++   KTT  ++ AC C+      +SG+       +P KC +      I+   +C+ ++
Sbjct  57   TINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYK-ISTSTNCATVK 115

Sequence Alignment: 64. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 39.3 bits 173,  Expect = 4e-05
 Identities = 29/113 25%, Positives = 58/113 51%, Gaps = 12/113 10%
Query  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
            M +V  A +VV+   +    +A+           CG+V  +++PC+ F++     P+  C
Sbjct  1    MASVKFACVVVLCMVVVGAHTAQGM--------TCGQVQSNLVPCVTFLQNGGFVPAG-C 51
Query  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADF 119
            C+G + +    ++T  +R  C C+  A   + G+       +P KC +   +P  I+   
Sbjct  52   CNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV--NIPYKISTST 109
Query  120  DCSKI 124
            +C+ I
Sbjct  110  NCASI 114

Sequence Alignment: 65. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 38.2 bits 167,  Expect = 6e-05
 Identities = 29/86 33%, Positives = 47/86 54%, Gaps = 9/86 10%
Query  35   CGKVVQDIMPCLHFVK--GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI- 91
            C  V + I PC+ ++K  G    P   CCSG + ++   KTT  ++  C C+  A   + 
Sbjct  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  92   SGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125
            S I     A +P KC +  ++P  I+   +CS I+
Sbjct  61   SQINPNNAASLPGKCGV--SIPYKISTSINCSSIK 93

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.