The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL
LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD
Sequence Info Allergen Name Length Opt Bits Score E Value
P50344 Cla h 12 110 683 142.0 3.6e-36
P49148 Alt a 12 110 497 105.7 3.1e-25
AEX34122 Pen cr 26.0101 107 477 101.7 4.5e-24
AAX11194 Pen b 26.0101 107 461 98.6 3.9e-23
CAA55067 Cla h 5.0101 111 258 59.0 3.5e-11
P42039 Cla h 5.0101 111 258 59.0 3.5e-11
Q9UUZ6 Asp f 8 111 247 56.8 1.6e-10
P42039 Cla h 10.0101 111 247 56.8 1.6e-10
P42037 Alt a 6 113 213 50.2 1.6e-08
AAB48041 Alt a 6 113 213 50.2 1.6e-08
AAL79930 Fus c 1 109 212 50.0 1.8e-08
Q8H2B9 Pru du 5.0101 113 193 46.3 2.4e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cla h 12 Sequence ID: P50344

 Score = 142.0 bits 683,  Expect = 4e-36
 Identities = 110/110 100%, Positives = 110/110 100%, Gaps = 0/110 0%
Query  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
            MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL
Sbjct  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
Query  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD
Sbjct  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110

Sequence Alignment: 2. Allergen Name: Alt a 12 Sequence ID: P49148

 Score = 105.7 bits 497,  Expect = 3e-25
 Identities = 81/110 73%, Positives = 91/110 82%, Gaps = 0/110 0%
Query  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
            MS +ELA+SYAALILAD+G++ITADKLQ+LI AAK+ E+EPIWT+LFAKALEGKDVKDLL
Sbjct  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
Query  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            LNVGSGGGAAP          AA     AEEK EEEKEESD+DMGFGLFD
Sbjct  61   LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110

Sequence Alignment: 3. Allergen Name: Pen cr 26.0101 Sequence ID: AEX34122

 Score = 101.7 bits 477,  Expect = 5e-24
 Identities = 79/107 73%, Positives = 91/107 85%, Gaps = 3/107 2%
Query  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
            MS AELA SYAALILAD+G+EI+ADK+Q LISAA V E+EPIW S+FA+ALEGKD+K+LL
Sbjct  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
Query  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
             NVGS G A+ A  GAA  GAAA  +  AEEK EEEKEESD+DMGFGLFD
Sbjct  61   TNVGSAGPASAAPAGAA--GAAAPAEEKAEEK-EEEKEESDEDMGFGLFD 107

Sequence Alignment: 4. Allergen Name: Pen b 26.0101 Sequence ID: AAX11194

 Score = 98.6 bits 461,  Expect = 4e-23
 Identities = 74/107 69%, Positives = 89/107 83%, Gaps = 3/107 2%
Query  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
            MS AELA SYAALILAD+G+E++ADK+Q ++ AAKV E+EPIW ++FAKALEGKD+K++L
Sbjct  1    MSTAELAVSYAALILADDGIEVSADKIQTILGAAKVQEVEPIWATIFAKALEGKDIKEIL 60
Query  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
             NVGS G A   AG  AA GAAA  +   EEK EEEKEESD+DMGFGLFD
Sbjct  61   TNVGSAGPA--TAGAPAAAGAAAPAEEKKEEK-EEEKEESDEDMGFGLFD 107

Sequence Alignment: 5. Allergen Name: Cla h 5.0101 Sequence ID: CAA55067

 Score = 59.0 bits 258,  Expect = 4e-11
 Identities = 50/85 58%, Positives = 64/85 75%, Gaps = 11/85 12%
Query  23   TADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSGG-GAAPAAG 74
            +A+ ++ ++S+  +   E   +SL+ K LEGKD+ +L       L +V SGG GAA A G
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSEKLASVPSGGAGAASAGG 77
Query  75   GAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
             AAAGGAA    AP  E+AEEEKEESDDDMGFGLFD
Sbjct  78   AAAAGGAAEA--APEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 6. Allergen Name: Cla h 5.0101 Sequence ID: P42039

 Score = 59.0 bits 258,  Expect = 4e-11
 Identities = 50/85 58%, Positives = 64/85 75%, Gaps = 11/85 12%
Query  23   TADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSGG-GAAPAAG 74
            +A+ ++ ++S+  +   E   +SL+ K LEGKD+ +L       L +V SGG GAA A G
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSEKLASVPSGGAGAASAGG 77
Query  75   GAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
             AAAGGAA    AP  E+AEEEKEESDDDMGFGLFD
Sbjct  78   AAAAGGAAEA--APEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 7. Allergen Name: Asp f 8 Sequence ID: Q9UUZ6

 Score = 56.8 bits 247,  Expect = 2e-10
 Identities = 54/96 56%, Positives = 71/96 73%, Gaps = 14/96 14%
Query  11   AALILADEG-LEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLN 62
            A L+LA  G    +++ ++A++S+  +   E     L A+ LEGKD+++L       L +
Sbjct  6    AFLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAE-LEGKDLQELIAEGSTKLAS 64
Query  63   VGSGGGAA--PAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            V SGG AA  PAA GAAAGGAAA     A+EK EEEKEESD+DMGFGLFD
Sbjct  65   VPSGGAAAAAPAAAGAAAGGAAA---PAAKEKNEEEKEESDEDMGFGLFD 111

Sequence Alignment: 8. Allergen Name: Cla h 10.0101 Sequence ID: P42039

 Score = 56.8 bits 247,  Expect = 2e-10
 Identities = 48/85 56%, Positives = 63/85 74%, Gaps = 11/85 12%
Query  23   TADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSGG-GAAPAAG 74
            +A+ ++ ++S+  +   E   +SL+ K LEGKD+ +L       L +V SGG GAAP+AG
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSQKLASVPSGGSGAAPSAG 77
Query  75   GAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            GAAA G A   +A  E   EEEKEESDDDMGFGLFD
Sbjct  78   GAAAAGGAT--EAAPEAAKEEEKEESDDDMGFGLFD 111

Sequence Alignment: 9. Allergen Name: Alt a 6 Sequence ID: P42037

 Score = 50.2 bits 213,  Expect = 2e-08
 Identities = 47/80 58%, Positives = 58/80 72%, Gaps = 25/80 31%
Query  14   ILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSG 66
            +L   G+E  +D+L  LIS                  LEGKD+ +L       L +V SG
Sbjct  26   VLESVGIEADSDRLDKLISE-----------------LEGKDINELIASGSEKLASVPSG 68
Query  67   G-GAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            G G A A+GGAAA G +A  +A  E   EEEKEESD+DMGFGLFD
Sbjct  69   GAGGAAASGGAAAAGGSAQAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 10. Allergen Name: Alt a 6 Sequence ID: AAB48041

 Score = 50.2 bits 213,  Expect = 2e-08
 Identities = 47/80 58%, Positives = 58/80 72%, Gaps = 25/80 31%
Query  14   ILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSG 66
            +L   G+E  +D+L  LIS                  LEGKD+ +L       L +V SG
Sbjct  26   VLESVGIEADSDRLDKLISE-----------------LEGKDINELIASGPEKLASVPSG 68
Query  67   G-GAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            G G A A+GGAAA G +A  +A  E   EEEKEESD+DMGFGLFD
Sbjct  69   GAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 11. Allergen Name: Fus c 1 Sequence ID: AAL79930

 Score = 50.0 bits 212,  Expect = 2e-08
 Identities = 43/84 51%, Positives = 59/84 70%, Gaps = 11/84 13%
Query  23   TADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSGGGAAPAAGG 75
            +A  ++A++++  +   E     L ++ LEGKD++ L       L +V SGG    + G 
Sbjct  19   SAADVKAVLTSVGIDADEDRLNKLISE-LEGKDIQQLIAEGSEKLASVPSGGAGGASGGA 77
Query  76   AAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            AAAGGAA   +A  EEK EEEKEESD+DMGFGLFD
Sbjct  78   AAAGGAAE--EAKEEEK-EEEKEESDEDMGFGLFD 109

Sequence Alignment: 12. Allergen Name: Pru du 5.0101 Sequence ID: Q8H2B9

 Score = 46.3 bits 193,  Expect = 2e-07
 Identities = 44/87 50%, Positives = 55/87 63%, Gaps = 11/87 12%
Query  14   ILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLLLNVGSGGGA-APA 72
            IL   G E   D++Q L+S  K  +I    T L A        ++ L +V SGGGA A A
Sbjct  26   ILGSVGAETDDDRIQLLLSEVKGKDI----TELIASG------REKLASVPSGGGAVAVA 75
Query  73   AGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110
            A GA AG AA     P +E+  EEKE++DDDMGF LFD
Sbjct  76   APGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD 113

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.