The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSHGKVIAVDNPIIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDV
DKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA
Sequence Info Allergen Name Length Opt Bits Score E Value
AJ937744 Asp f 28.0101 108 710 189.5 1.7e-50
AJ937745 Asp f 29.0101 110 314 87.6 8e-20
Q9UW02 Cop c 2 106 302 84.6 6.5e-19
Q4W1F7 Zea m 25.0101 128 266 75.2 5.1e-16
Q9LDX4 Tri a 25.0101 125 263 74.5 8.5e-16
CBW45298 Plo i 2.0101 106 260 73.8 1.2e-15
CAI78451 Mala s 13.0101 105 257 73.0 1.9e-15
AAL79931 Fus c 2 121 238 68.0 7e-14
CAA58999 Alt a 4 433 124 38.0 0.00027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asp f 28.0101 Sequence ID: AJ937744

 Score = 189.5 bits 710,  Expect = 2e-50
 Identities = 108/108 100%, Positives = 108/108 100%, Gaps = 0/108 0%
Query  1    MSHGKVIAVDNPIIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDV 60
            MSHGKVIAVDNPIIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDV
Sbjct  1    MSHGKVIAVDNPIIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDV 60
Query  61   DKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA 108
            DKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA
Sbjct  61   DKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA 108

Sequence Alignment: 2. Allergen Name: Asp f 29.0101 Sequence ID: AJ937745

 Score = 87.6 bits 314,  Expect = 8e-20
 Identities = 49/104 47%, Positives = 69/104 66%, Gaps = 4/104 3%
Query  1    MSHGKVIAVDNPIIY-KALTSSGPVVVDFFATWCGPCRAVAPKVGELS--EKYSNVRFIQ 57
            MSH      D  +   K    SGPV+VD  ATWCGPC+A++P    LS  E++ N +F +
Sbjct  1    MSHNVEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYE 60
Query  58   VDVDKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKS 105
            +DVD++  VA E+ +RAMPTF+++KDGQ + + VVG N   LE  IK+
Sbjct  61   IDVDELSEVAAELGVRAMPTFMFFKDGQKVNE-VVGANPPALEAAIKA 107

Sequence Alignment: 3. Allergen Name: Cop c 2 Sequence ID: Q9UW02

 Score = 84.6 bits 302,  Expect = 6e-19
 Identities = 45/98 45%, Positives = 69/98 70%, Gaps = 4/98 4%
Query  6    VIAVDNPIIYKALTSSGPVVV-DFFATWCGPCRAVAPKVGELSEKY--SNVRFIQVDVDK 62
            V  + N   +  LT+SG +++ DF+ATWCGPCR ++P   ++SEKY  +N+ F +VDVD 
Sbjct  2    VQVISNLDEFNKLTNSGKIIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKVDVDT 61
Query  63   VRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIK 104
               ++ E  IRAMPTF +YKDGQ +++ +VG N   LE +++
Sbjct  62   ASDISEEAKIRAMPTFQVYKDGQKIDE-LVGANPTALESLVQ 102

Sequence Alignment: 4. Allergen Name: Zea m 25.0101 Sequence ID: Q4W1F7

 Score = 75.2 bits 266,  Expect = 5e-16
 Identities = 42/97 43%, Positives = 70/97 72%, Gaps = 6/97 6%
Query  2    SHGKVIAVDN----PI-IYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFI 56
            + G VIA+ +     I I +A ++   VV+DF ATWC PCRA+AP   ++++K  NV F+
Sbjct  17   TEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFL 76
Query  57   QVDVDKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVREL 99
            +VDVD+++++A + ++ AMPTF++ ++G  ++ RVVG    EL
Sbjct  77   KVDVDEMKTIAEQFSVEAMPTFLFMREGD-VKDRVVGAAKEEL 118

Sequence Alignment: 5. Allergen Name: Tri a 25.0101 Sequence ID: Q9LDX4

 Score = 74.5 bits 263,  Expect = 8e-16
 Identities = 35/79 44%, Positives = 57/79 72%, Gaps = 1/79 1%
Query  24   VVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDVDKVRSVAHEMNIRAMPTFVLYKD 83
            VV+DF A+WCGPCR +AP   +L++K+    F++VDVD+++S+A + ++ AMPTF++ K+
Sbjct  41   VVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKE 100
Query  84   GQPLEKRVVGGNVRELEEMI 103
            G  ++ RVVG    EL   +
Sbjct  101  GD-VKDRVVGAIKEELTNKV 119

Sequence Alignment: 6. Allergen Name: Plo i 2.0101 Sequence ID: CBW45298

 Score = 73.8 bits 260,  Expect = 1e-15
 Identities = 38/85 44%, Positives = 60/85 70%, Gaps = 4/85 4%
Query  18   LTSSGP--VVVDFFATWCGPCRAVAPKVGELSEKYSN-VRFIQVDVDKVRSVAHEMNIRA 74
            LT +G   VV+DF ATWCGPC+ + PK+ E++ + ++ +  ++VDVD+   +A E +I  
Sbjct  15   LTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDVDECEDIATEYSINT 74
Query  75   MPTFVLYKDGQPLEKRVVGGNVRELEEMI 103
            MPTFV+ K+G+P+E+   G NV +L   I
Sbjct  75   MPTFVFVKNGKPVEQ-FSGANVEKLRSTI 102

Sequence Alignment: 7. Allergen Name: Mala s 13.0101 Sequence ID: CAI78451

 Score = 73.0 bits 257,  Expect = 2e-15
 Identities = 42/93 45%, Positives = 64/93 68%, Gaps = 4/93 4%
Query  15   YKALTSSGPVVV-DFFATWCGPCRAVAPKVGELSEKYSN--VRFIQVDVDKVRSVAHEMN 71
            +K +T    VVV DF+ATWCGPC+ + P   ++S+  +   V F +VDVD+   +A+E+ 
Sbjct  10   FKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDEQSQIAQEVG 69
Query  72   IRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA 108
            IRAMPTFV++K+GQ ++  VVG +  +L+  I   SA
Sbjct  70   IRAMPTFVFFKNGQKIDT-VVGADPSKLQAAITQHSA 105

Sequence Alignment: 8. Allergen Name: Fus c 2 Sequence ID: AAL79931

 Score = 68.0 bits 238,  Expect = 7e-14
 Identities = 36/75 48%, Positives = 54/75 72%, Gaps = 3/75 4%
Query  11   NPIIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSN---VRFIQVDVDKVRSVA 67
            N  + K L+S+  VVVDFFA WC PC+A+AP   +LS K+S    + F +V+VD V+  A
Sbjct  8    NDELQKLLSSTTYVVVDFFADWCPPCKAIAPVYEQLSTKHSVPDVLAFAKVNVDHVQDAA 67
Query  68   HEMNIRAMPTFVLYKDGQ 85
            ++  I AMPTF+++K+G+
Sbjct  68   QQYGITAMPTFMFFKEGK 85

Sequence Alignment: 9. Allergen Name: Alt a 4 Sequence ID: CAA58999

 Score = 38.0 bits 124,  Expect = 0.0003
 Identities = 18/47 38%, Positives = 33/47 70%, Gaps = 1/47 2%
Query  24   VVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQ-VDVDKVRSVAHEM 70
            V+V+F+A WCG C+A+APK  EL + Y++  + + V + KV +  +++
Sbjct  254  VLVEFYAPWCGHCKALAPKYEELGQLYASDELSKLVTIAKVDATLNDV 301

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.