The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSIRSINLLTRQTIPGSLISIIGINNNFHNRYIYFSFKHPHQSFKYHHLSSASLSINFSI
SKNVHYKQQPYNIGNKVHFVQNHQLRKFFATKTNNKMSTNYSVDNRGALNSLDYRIYFKN
DSNGKIISPWHDIPLFADKSAKQYNMVVEIPRWTNEKMEIATAEPMTPIKQDVKKGALRY
VKNVFPHKGYIWNYGAFPQTWENPNHIDQGTKAKGDNDPIDVIEIGSRIAKRGDVIPVKI
LGTIALIDEGETDWKIITIDTRDELAGQMNNVDDVEKLLPGLLRATVEWFRIYKIPDGKP
ANKFAFNGEAKDREFAEKVVEETHQYWREMMENKAGEHQLDLKNITLGNSYTINDEQAKQ
FLETRPASNTVEPNPIADQVAIDKWHHVKLI
Sequence Info Allergen Name Length Opt Bits Score E Value
QAT18643 Der p 32.0101 391 2634 606.8 5.4e-175
AIO08849 Der f 32.0101 296 1869 432.5 1.2e-122
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 32.0101 Sequence ID: QAT18643

 Score = 606.8 bits 2634,  Expect = 5e-175
 Identities = 391/391 100%, Positives = 391/391 100%, Gaps = 0/391 0%
Query  1    MSIRSINLLTRQTIPGSLISIIGINNNFHNRYIYFSFKHPHQSFKYHHLSSASLSINFSI 60
            MSIRSINLLTRQTIPGSLISIIGINNNFHNRYIYFSFKHPHQSFKYHHLSSASLSINFSI
Sbjct  1    MSIRSINLLTRQTIPGSLISIIGINNNFHNRYIYFSFKHPHQSFKYHHLSSASLSINFSI 60
Query  61   SKNVHYKQQPYNIGNKVHFVQNHQLRKFFATKTNNKMSTNYSVDNRGALNSLDYRIYFKN 120
            SKNVHYKQQPYNIGNKVHFVQNHQLRKFFATKTNNKMSTNYSVDNRGALNSLDYRIYFKN
Sbjct  61   SKNVHYKQQPYNIGNKVHFVQNHQLRKFFATKTNNKMSTNYSVDNRGALNSLDYRIYFKN 120
Query  121  DSNGKIISPWHDIPLFADKSAKQYNMVVEIPRWTNEKMEIATAEPMTPIKQDVKKGALRY 180
            DSNGKIISPWHDIPLFADKSAKQYNMVVEIPRWTNEKMEIATAEPMTPIKQDVKKGALRY
Sbjct  121  DSNGKIISPWHDIPLFADKSAKQYNMVVEIPRWTNEKMEIATAEPMTPIKQDVKKGALRY 180
Query  181  VKNVFPHKGYIWNYGAFPQTWENPNHIDQGTKAKGDNDPIDVIEIGSRIAKRGDVIPVKI 240
            VKNVFPHKGYIWNYGAFPQTWENPNHIDQGTKAKGDNDPIDVIEIGSRIAKRGDVIPVKI
Sbjct  181  VKNVFPHKGYIWNYGAFPQTWENPNHIDQGTKAKGDNDPIDVIEIGSRIAKRGDVIPVKI 240
Query  241  LGTIALIDEGETDWKIITIDTRDELAGQMNNVDDVEKLLPGLLRATVEWFRIYKIPDGKP 300
            LGTIALIDEGETDWKIITIDTRDELAGQMNNVDDVEKLLPGLLRATVEWFRIYKIPDGKP
Sbjct  241  LGTIALIDEGETDWKIITIDTRDELAGQMNNVDDVEKLLPGLLRATVEWFRIYKIPDGKP 300
Query  301  ANKFAFNGEAKDREFAEKVVEETHQYWREMMENKAGEHQLDLKNITLGNSYTINDEQAKQ 360
            ANKFAFNGEAKDREFAEKVVEETHQYWREMMENKAGEHQLDLKNITLGNSYTINDEQAKQ
Sbjct  301  ANKFAFNGEAKDREFAEKVVEETHQYWREMMENKAGEHQLDLKNITLGNSYTINDEQAKQ 360
Query  361  FLETRPASNTVEPNPIADQVAIDKWHHVKLI 391
            FLETRPASNTVEPNPIADQVAIDKWHHVKLI
Sbjct  361  FLETRPASNTVEPNPIADQVAIDKWHHVKLI 391

Sequence Alignment: 2. Allergen Name: Der f 32.0101 Sequence ID: AIO08849

 Score = 432.5 bits 1869,  Expect = 1e-122
 Identities = 266/294 90%, Positives = 287/294 97%, Gaps = 0/294 0%
Query  98   STNYSVDNRGALNSLDYRIYFKNDSNGKIISPWHDIPLFADKSAKQYNMVVEIPRWTNEK 157
            +TNYSVD+RG++NSLDYRIYFK++SNGKIISPWHDIPLF DKSAK+YNMVVEIPRWTNEK
Sbjct  3    TTNYSVDHRGSFNSLDYRIYFKDNSNGKIISPWHDIPLFVDKSAKHYNMVVEIPRWTNEK 62
Query  158  MEIATAEPMTPIKQDVKKGALRYVKNVFPHKGYIWNYGAFPQTWENPNHIDQGTKAKGDN 217
            MEIATAEPM+PIKQD+KKGALRYVKNVFPHKGYIWNYGAFPQTWENPNHIDQ TK KGDN
Sbjct  63   MEIATAEPMSPIKQDIKKGALRYVKNVFPHKGYIWNYGAFPQTWENPNHIDQDTKTKGDN 122
Query  218  DPIDVIEIGSRIAKRGDVIPVKILGTIALIDEGETDWKIITIDTRDELAGQMNNVDDVEK 277
            DPIDVIEIGSR+AKRGDV+PVKILGTIALIDEGETDWKII IDTRDELA QMNNVDDVEK
Sbjct  123  DPIDVIEIGSRVAKRGDVVPVKILGTIALIDEGETDWKIIAIDTRDELASQMNNVDDVEK 182
Query  278  LLPGLLRATVEWFRIYKIPDGKPANKFAFNGEAKDREFAEKVVEETHQYWREMMENKAGE 337
            LLPGLLRATVEWF+IYKIPDGKPANKFAFNGEAKDREFAEK+VEETHQYW+EMMENK+GE
Sbjct  183  LLPGLLRATVEWFKIYKIPDGKPANKFAFNGEAKDREFAEKIVEETHQYWQEMMENKSGE 242
Query  338  HQLDLKNITLGNSYTINDEQAKQFLETRPASNTVEPNPIADQVAIDKWHHVKLI 391
            H+LDLKN+TLGNS++INDEQAKQFLETRP+S+ VEP PIADQVAIDKWHHVKLI
Sbjct  243  HKLDLKNVTLGNSFSINDEQAKQFLETRPSSDAVEPTPIADQVAIDKWHHVKLI 296

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.