The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSLKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVC
SANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSK
SIGWADEEGRTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD42074 Pen c 3 167 1097 254.8 9.3e-70
O43099 Asp f 3 168 905 211.5 9.5e-57
CAA09883 Mala s 5 172 441 107.1 2.6e-25
P56577 Mala f 2 177 413 100.8 2.2e-23
P56578 Mala f 3 166 382 93.9 2.5e-21
AAA34358 Cand b 2 167 307 77.0 3e-16
AAA34357 Cand b 2 167 301 75.6 7.7e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pen c 3 Sequence ID: AAD42074

 Score = 254.8 bits 1097,  Expect = 9e-70
 Identities = 167/167 100%, Positives = 167/167 100%, Gaps = 0/167 0%
Query  1    MSLKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVC 60
            MSLKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVC
Sbjct  1    MSLKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVC 60
Query  61   SANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSK 120
            SANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSK
Sbjct  61   SANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSK 120
Query  121  SIGWADEEGRTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL 167
            SIGWADEEGRTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL
Sbjct  121  SIGWADEEGRTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL 167

Sequence Alignment: 2. Allergen Name: Asp f 3 Sequence ID: O43099

 Score = 211.5 bits 905,  Expect = 1e-56
 Identities = 136/165 82%, Positives = 149/165 90%, Gaps = 0/165 0%
Query  3    LKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSA 62
            LKAGDSFP  V FSYIPW+ED  EIT+CGIPINYNASKE+A+KKV+LFALPGAFTPVCSA
Sbjct  4    LKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSA 63
Query  63   NHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSKSI 122
             HVPEYI+KLPE+RAKGVD VAVLAYNDAYVMSAWGKAN VTGDDILFLSDP+A+FSKSI
Sbjct  64   RHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSI 123
Query  123  GWADEEGRTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL 167
            GWADEEGRT RY LVID+GKI YAA E AKN LE+S A+ VLK+L
Sbjct  124  GWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL 168

Sequence Alignment: 3. Allergen Name: Mala s 5 Sequence ID: CAA09883

 Score = 107.1 bits 441,  Expect = 3e-25
 Identities = 75/165 45%, Positives = 101/165 61%, Gaps = 9/165 5%
Query  1    MSLKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVC 60
            MS   G   P   TF+YIPWA +      CG+P  + A   +  KKVV+ A+PGAFTP C
Sbjct  1    MSATTGSQAPN-TTFTYIPWAPELDSGKVCGVPQTFKAHDRWKGKKVVVVAIPGAFTPAC 59
Query  61   SANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSK 120
              NH+P +++K+ EL+AKGVD+V V+A NDA+VMS WG   G   D I++  D +  FSK
Sbjct  60   HQNHIPGFVEKINELKAKGVDEVVVIAVNDAFVMSGWGVTVG-GKDQIVYACDNDLAFSK 118
Query  121  SIGWADE--EG----RTYRYVLVIDNGKIIY-AAKEAAKNSLELSRADHVLKQL 167
            ++G   +   G    RT RY +V+D+ KI Y    E    + E S  D VL QL
Sbjct  119  ALGGTLDLTSGGMGVRTARYAVVLDDLKITYFGMDEGNMGAPEKSSVDAVLAQL 172

Sequence Alignment: 4. Allergen Name: Mala f 2 Sequence ID: P56577

 Score = 100.8 bits 413,  Expect = 2e-23
 Identities = 64/160 40%, Positives = 99/160 61%, Gaps = 9/160 5%
Query  6    GDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSANHV 65
            G+  P+     YIPW  +      CGIP  +    E+  KKVV+ ++PGA+TP+C   H+
Sbjct  11   GNEIPD-TLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQHI 69
Query  66   PEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSKSIGW- 124
            P  ++++ EL+AKGVD V V+A ND +VM+AWG  N    D ++F +D +  FSK++G  
Sbjct  70   PPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAK-DKVVFATDIDLAFSKALGAT 128
Query  125  ----ADEEG-RTYRYVLVIDNGKII-YAAKEAAKNSLELSRADHVLKQL 167
                A   G RT RY L+ID+ KI+ +A+ E     L+ +  D +L ++
Sbjct  129  IDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177

Sequence Alignment: 5. Allergen Name: Mala f 3 Sequence ID: P56578

 Score = 93.9 bits 382,  Expect = 2e-21
 Identities = 62/158 39%, Positives = 100/158 63%, Gaps = 10/158 6%
Query  6    GDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSANHV 65
            G + P   TF+Y+P++ +  +   CG+P ++ + + +  KKVV+ A+PGAFTP C+ANHV
Sbjct  3    GSTIPNA-TFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHV 61
Query  66   PEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSKSIGWA 125
            P Y++K+ EL++KGVD+V V++ ND +V+SAWG       D++ F  D   +FSK     
Sbjct  62   PPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAK-DNLTFAQDVNCEFSKHFNAT 120
Query  126  ---DEEG---RTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL 167
                 +G   RT RY L+ ++ K+ Y   +  +   + S A  VL +L
Sbjct  121  LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEP--KQSSAATVLSKL 166

Sequence Alignment: 6. Allergen Name: Cand b 2 Sequence ID: AAA34358

 Score = 77.0 bits 307,  Expect = 3e-16
 Identities = 58/156 37%, Positives = 89/156 57%, Gaps = 17/156 10%
Query  3    LKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSA 62
            +K GD FP      YIP           G P  +  SK    KK V+ ++PGAFTP C+ 
Sbjct  4    IKRGDRFPTTDDVYYIP--------PEGGEPGAFELSKFVKTKKFVVVSVPGAFTPPCTE 55
Query  63   NHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVT-GDDILFLSDPEAKFSKS 121
             H+P YI+ LP + +KGVD V V+  ND +V+  W K  G      ++F+SDP  K++K 
Sbjct  56   QHLPGYIKNLPRILSKGVDFVLVITQNDPFVLKGWKKELGAADAKKLIFVSDPNLKLTKK 115
Query  122  IGWADEEG------RTYRYVLVIDNGKII-YAAKEAAKNSLELSRADHVLKQL 167
            +G   +        R+ R  L+++   I+ YAA E     +++S A  ++ +L
Sbjct  116  LGSTIDLSSIGLGTRSGRLALIVNRSGIVEYAAIENG-GEVDVSTAQKIIAKL 167

Sequence Alignment: 7. Allergen Name: Cand b 2 Sequence ID: AAA34357

 Score = 75.6 bits 301,  Expect = 8e-16
 Identities = 58/156 37%, Positives = 89/156 57%, Gaps = 17/156 10%
Query  3    LKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSA 62
            +K GD FP      YIP           G P     SK    KK V+ ++PGAFTP C+ 
Sbjct  4    IKRGDRFPTTDDVYYIP--------PEGGEPGPLELSKFVKTKKFVVVSVPGAFTPPCTE 55
Query  63   NHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVT-GDDILFLSDPEAKFSKS 121
             H+P YI+ LP + +KGVD V V++ ND +V+  W K  G      ++F+SDP  K++K 
Sbjct  56   QHLPGYIKNLPRILSKGVDFVLVISQNDPFVLKGWKKELGAADAKKLVFVSDPNLKLTKK 115
Query  122  IGWADEEG------RTYRYVLVIDNGKII-YAAKEAAKNSLELSRADHVLKQL 167
            +G   +        R+ R  L+++   I+ YAA E     +++S A  ++ +L
Sbjct  116  LGSTIDLSAIGLGTRSGRLALIVNRSGIVEYAAIENG-GEVDVSTAQKIIAKL 167

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.