The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFML
QGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWL
DGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCGVC
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA09884 Mala s 6 162 1096 313.1 2.4e-87
AJ937743 Asp f 27.0101 163 848 243.7 1.9e-66
A1KXG2 Der f 29.0101 164 792 228.0 1e-61
ALM24136 Rhi o 2.0101 164 777 223.8 1.8e-60
AVV30163 Ole e 15.0101 172 743 214.3 1.4e-57
CAA59468 Cat r 1.0101 172 732 211.2 1.2e-56
P21568 Sola l 5.0101 171 723 208.7 6.9e-56
A0A444XS96 Ara h 18.0101 226 721 208.0 1.4e-55
Q8L5T1 Bet v 7 173 715 206.4 3.3e-55
QAT18640 Der p 29.0101 247 717 206.8 3.5e-55
CAB44442 Asp f 11 178 695 200.8 1.7e-53
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mala s 6 Sequence ID: CAA09884

 Score = 313.1 bits 1096,  Expect = 2e-87
 Identities = 162/162 100%, Positives = 162/162 100%, Gaps = 0/162 0%
Query  1    MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFML 60
            MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFML
Sbjct  1    MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFML 60
Query  61   QGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWL 120
            QGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWL
Sbjct  61   QGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWL 120
Query  121  DGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCGVC 162
            DGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCGVC
Sbjct  121  DGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCGVC 162

Sequence Alignment: 2. Allergen Name: Asp f 27.0101 Sequence ID: AJ937743

 Score = 243.7 bits 848,  Expect = 2e-66
 Identities = 123/156 78%, Positives = 133/156 85%, Gaps = 0/156 0%
Query  5    FFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFMLQGGD 64
            FFDIT +G P G I FKLFD+VVPKT  NFRALCTGEKGFGY GS FHR+IP FMLQGGD
Sbjct  6    FFDITIDGQPAGRITFKLFDEVVPKTVENFRALCTGEKGFGYKGSSFHRIIPQFMLQGGD 65
Query  65   FTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKH 124
            FT GNGTGGKSIYG +F DENFQLKH+KPGLLSMANAG NTNGSQFFITTVVTSWLDG H
Sbjct  66   FTKGNGTGGKSIYGDRFPDENFQLKHDKPGLLSMANAGKNTNGSQFFITTVVTSWLDGAH 125
Query  125  VVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            VVFGEV DGM++VK IE+ GS SG P+ +I IA CG
Sbjct  126  VVFGEVEDGMDLVKKIESYGSASGTPKKKITIADCG 161

Sequence Alignment: 3. Allergen Name: Der f 29.0101 Sequence ID: A1KXG2

 Score = 228.0 bits 792,  Expect = 1e-61
 Identities = 111/160 69%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFML 60
            +  VFFDI  +  PLG I  +L  DVVPKTA NFRALCTGEKGFG+  S FHR+IP+FM+
Sbjct  3    LPRVFFDIAADNQPLGRIVIELRSDVVPKTAENFRALCTGEKGFGFKSSSFHRIIPNFMI 62
Query  61   QGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWL 120
            QGGDFT  NGTGGKSIYG KFADENF L+H  PG++SMANAGPNTNGSQFFITTV T+WL
Sbjct  63   QGGDFTNHNGTGGKSIYGNKFADENFTLQHTGPGIMSMANAGPNTNGSQFFITTVKTTWL 122
Query  121  DGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            DGKHVVFG V++GM++VK +E+ GS SGKP  ++ IA CG
Sbjct  123  DGKHVVFGSVVEGMDIVKKVESYGSQSGKPSKKVTIANCG 162

Sequence Alignment: 4. Allergen Name: Rhi o 2.0101 Sequence ID: ALM24136

 Score = 223.8 bits 777,  Expect = 2e-60
 Identities = 116/160 72%, Positives = 129/160 80%, Gaps = 2/160 1%
Query  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDF 58
            MSN  VFFD++ N  PLG I  +L  DVVP+TA NFRALCTGEKGFGY G  FHRVIP+F
Sbjct  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF 60
Query  59   MLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTS 118
            MLQGGDFT  NGTGGKSIYG KF DENF LKH  PG LSMANAGPNTNGSQFFITT+  S
Sbjct  61   MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS 120
Query  119  WLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            WLDGKHVVFG V +GM+VV+ IE+ GS +G PR++I I  CG
Sbjct  121  WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCG 162

Sequence Alignment: 5. Allergen Name: Ole e 15.0101 Sequence ID: AVV30163

 Score = 214.3 bits 743,  Expect = 1e-57
 Identities = 114/160 71%, Positives = 129/160 80%, Gaps = 9/160 5%
Query  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG-------YAGSHF 51
            M+N  VFFD+T  G P+G I  +LF DVVP+T+ NFRALCTGEKG G       Y GS F
Sbjct  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
Query  52   HRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFF 111
            HRVIP+FM QGGDFTAGNGTGG+SIYG+KFADENF  KH  PG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  112  ITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            I T  T WLDGKHVVFG+V++G  VVKAIE  GSGSGK    + +A CG
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCG 169

Sequence Alignment: 6. Allergen Name: Cat r 1.0101 Sequence ID: CAA59468

 Score = 211.2 bits 732,  Expect = 1e-56
 Identities = 109/157 69%, Positives = 124/157 78%, Gaps = 7/157 4%
Query  4    VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAG-------SHFHRVIP 56
            VFFD++  G P G I  +LF D  P+TA NFRALCTGEKG G +G       S FHRVIP
Sbjct  6    VFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSFHRVIP 65
Query  57   DFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVV 116
             FM QGGDFTAGNGTGG+SIYGAKFADENF  KH  PG+LSMANAGPNTNGSQFFI T  
Sbjct  66   GFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFFICTAK 125
Query  117  TSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            T WLDGKHVVFG+V++GM+VVKAIE  GS SG+   ++ +  CG
Sbjct  126  TEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCG 169

Sequence Alignment: 7. Allergen Name: Sola l 5.0101 Sequence ID: P21568

 Score = 208.7 bits 723,  Expect = 7e-56
 Identities = 111/160 69%, Positives = 125/160 78%, Gaps = 9/160 5%
Query  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG-------YAGSHF 51
            M+N  VFFD+T  GAP G +  +LF D  PKTA NFRALCTGEKG G       Y GS F
Sbjct  1    MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF 60
Query  52   HRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFF 111
            HRVIP FM QGGDFTAGNGTGG+SIYGAKF DENF  KH  PG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  112  ITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            I T  T WL+GKHVVFG+V++GM+V+K  EA GS SG+    + IA CG
Sbjct  121  ICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCG 169

Sequence Alignment: 8. Allergen Name: Ara h 18.0101 Sequence ID: A0A444XS96

 Score = 208.0 bits 721,  Expect = 1e-55
 Identities = 110/162 67%, Positives = 128/162 79%, Gaps = 10/162 6%
Query  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG-------YAGSHF 51
            M+N  VFFD+T  G P G I  +LF D  P+TA NFRALCTGEKG G       Y GS F
Sbjct  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
Query  52   HRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFF 111
            HRVIP+FM QGGDFTAGNGTGG+SIYG+KFADENF  KH  PG+LSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
Query  112  ITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG-VC 162
            I T  T WLDGKHVVFG+V++G++VV+ IE  GS SG+    + +A CG +C
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQLC 172

Sequence Alignment: 9. Allergen Name: Bet v 7 Sequence ID: Q8L5T1

 Score = 206.4 bits 715,  Expect = 3e-55
 Identities = 106/157 67%, Positives = 123/157 78%, Gaps = 7/157 4%
Query  4    VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAG-------SHFHRVIP 56
            VFFD+   G P+G I  +L+ D  P+TA NFRALCTGEKG G +G       S FHRVIP
Sbjct  7    VFFDMEVGGQPVGRIVMELYADTTPRTAENFRALCTGEKGNGRSGKPLHYKKSSFHRVIP 66
Query  57   DFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVV 116
             FM QGGDFTAGNGTGG+SIYGAKFADENF  KH  PG+LSMANAGP TNGSQFFI T  
Sbjct  67   GFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFICTAK 126
Query  117  TSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            T WLDGKHVVFG+V++G+++VKAIE  GS SG+    + +A CG
Sbjct  127  TEWLDGKHVVFGQVVEGLDIVKAIEKVGSSSGRTSKPVVVADCG 170

Sequence Alignment: 10. Allergen Name: Der p 29.0101 Sequence ID: QAT18640

 Score = 206.8 bits 717,  Expect = 4e-55
 Identities = 106/157 67%, Positives = 118/157 75%, Gaps = 0/157 0%
Query  4    VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFMLQGG 63
            VFFDI  +    G I   L  DVVPKT  NFR LCT EKGFG+ GS FHR+IP FM+QGG
Sbjct  88   VFFDIRVDNQYCGRIVILLRKDVVPKTTENFRCLCTHEKGFGFRGSIFHRIIPGFMIQGG 147
Query  64   DFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGK 123
            DFT  NGTGGKSIYG KF DENFQLKH   G LSMAN+GPNTNGSQFFIT   T WLDGK
Sbjct  148  DFTNHNGTGGKSIYGRKFEDENFQLKHTGAGTLSMANSGPNTNGSQFFITASRTEWLDGK 207
Query  124  HVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160
            HVVFG+V+ GM++V+ IE  GS SGKP  R++IA CG
Sbjct  208  HVVFGQVMQGMDIVRKIEECGSKSGKPNKRVKIANCG 244

Sequence Alignment: 11. Allergen Name: Asp f 11 Sequence ID: CAB44442

 Score = 200.8 bits 695,  Expect = 2e-53
 Identities = 114/158 72%, Positives = 124/158 78%, Gaps = 13/158 8%
Query  1    MSNVFFDITKNGAPLGT-------IKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHR 53
            MS VFFD+    AP+GT       I F LFD  VPKTA NFR LC    G GY  S FHR
Sbjct  8    MSQVFFDVEY--APVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEGYRESTFHR 65
Query  54   VIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFIT 113
            +IP+FM+QGGDFT GNGTGG+SIYG KFADENF  KH+K G+LSMANAGPNTNGSQFFIT
Sbjct  66   IIPNFMIQGGDFTRGNGTGGRSIYGDKFADENFSRKHDKKGILSMANAGPNTNGSQFFIT 125
Query  114  TVVTSWLDGKHVVFGEVID--GMNVVKAIEAEGSGSGKPRS--RIEIAKCG 160
            T VTSWLDGKHVVFGEV D    +VVK IEA GS SG  RS  R +I  CG
Sbjct  126  TAVTSWLDGKHVVFGEVADEKSYSVVKEIEALGSSSGSVRSNTRPKIVNCG 176

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.