The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSSSLEQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAALIDTAVAYG
KQNGKTLDEQVEATLDRLLVEFGKEILKIIPGKVSTEVDAKLSFDTQGSVNKALEIIKLY
ADNGISKDRVLIKIASTYEGIKAAHILQTQHGINCNLTLMFSLVQAIAAAEAGAYLISPF
VGRILDWYKAAHKRDYTPQEDPGVKSVQDIYNYYKKFGYNTIVMGASFRNVGEITELAGC
DYLTISPNLLEDLFNSTDAVPQKLNPAGAASLEIKKREYLNNEADFRFDFNEEAMGVEKL
REGISKFAADAVTLKQLLAQKIQA
Sequence Info Allergen Name Length Opt Bits Score E Value
ADK27483 Pen ch 35.0101 324 2051 474.0 3.5e-135
AHY02994 Fus p 4.0101 323 1607 372.8 1e-104
ADK47394 Cla c 14.0101 325 1583 367.3 4.6e-103
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pen ch 35.0101 Sequence ID: ADK27483

 Score = 474.0 bits 2051,  Expect = 3e-135
 Identities = 324/324 100%, Positives = 324/324 100%, Gaps = 0/324 0%
Query  1    MSSSLEQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAALIDTAVAYG 60
            MSSSLEQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAALIDTAVAYG
Sbjct  1    MSSSLEQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAALIDTAVAYG 60
Query  61   KQNGKTLDEQVEATLDRLLVEFGKEILKIIPGKVSTEVDAKLSFDTQGSVNKALEIIKLY 120
            KQNGKTLDEQVEATLDRLLVEFGKEILKIIPGKVSTEVDAKLSFDTQGSVNKALEIIKLY
Sbjct  61   KQNGKTLDEQVEATLDRLLVEFGKEILKIIPGKVSTEVDAKLSFDTQGSVNKALEIIKLY 120
Query  121  ADNGISKDRVLIKIASTYEGIKAAHILQTQHGINCNLTLMFSLVQAIAAAEAGAYLISPF 180
            ADNGISKDRVLIKIASTYEGIKAAHILQTQHGINCNLTLMFSLVQAIAAAEAGAYLISPF
Sbjct  121  ADNGISKDRVLIKIASTYEGIKAAHILQTQHGINCNLTLMFSLVQAIAAAEAGAYLISPF 180
Query  181  VGRILDWYKAAHKRDYTPQEDPGVKSVQDIYNYYKKFGYNTIVMGASFRNVGEITELAGC 240
            VGRILDWYKAAHKRDYTPQEDPGVKSVQDIYNYYKKFGYNTIVMGASFRNVGEITELAGC
Sbjct  181  VGRILDWYKAAHKRDYTPQEDPGVKSVQDIYNYYKKFGYNTIVMGASFRNVGEITELAGC 240
Query  241  DYLTISPNLLEDLFNSTDAVPQKLNPAGAASLEIKKREYLNNEADFRFDFNEEAMGVEKL 300
            DYLTISPNLLEDLFNSTDAVPQKLNPAGAASLEIKKREYLNNEADFRFDFNEEAMGVEKL
Sbjct  241  DYLTISPNLLEDLFNSTDAVPQKLNPAGAASLEIKKREYLNNEADFRFDFNEEAMGVEKL 300
Query  301  REGISKFAADAVTLKQLLAQKIQA 324
            REGISKFAADAVTLKQLLAQKIQA
Sbjct  301  REGISKFAADAVTLKQLLAQKIQA 324

Sequence Alignment: 2. Allergen Name: Fus p 4.0101 Sequence ID: AHY02994

 Score = 372.8 bits 1607,  Expect = 1e-104
 Identities = 248/322 77%, Positives = 287/322 89%, Gaps = 0/322 0%
Query  1    MSSSLEQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAALIDTAVAYG 60
            MSSSLEQLKA+GTTVV DSGDF +IGKYKPQDATTNPSLILAASKK EYA LID A+ Y 
Sbjct  1    MSSSLEQLKATGTTVVSDSGDFVSIGKYKPQDATTNPSLILAASKKAEYAKLIDVAIDYA 60
Query  61   KQNGKTLDEQVEATLDRLLVEFGKEILKIIPGKVSTEVDAKLSFDTQGSVNKALEIIKLY 120
            KQ G ++D+QV+  LDRLLVEFGKEILKIIPGKVSTEVDA+ SFDT+ SVNKAL +I+LY
Sbjct  61   KQKGGSIDQQVDDALDRLLVEFGKEILKIIPGKVSTEVDARYSFDTEASVNKALHLIELY 120
Query  121  ADNGISKDRVLIKIASTYEGIKAAHILQTQHGINCNLTLMFSLVQAIAAAEAGAYLISPF 180
             + GISKDR+LIKIA+T+EGIKAA ILQ  HGIN NLTLMFSLVQAI AAEAGAYLISPF
Sbjct  121  GEQGISKDRILIKIAATWEGIKAAEILQRDHGINTNLTLMFSLVQAIGAAEAGAYLISPF 180
Query  181  VGRILDWYKAAHKRDYTPQEDPGVKSVQDIYNYYKKFGYNTIVMGASFRNVGEITELAGC 240
            VGRILDW+KA+ K++Y+ +EDPGV+SV+ I+NYYKK+GYNTIVMGASFRN GEITELAGC
Sbjct  181  VGRILDWFKASTKKEYSKEEDPGVQSVKTIFNYYKKYGYNTIVMGASFRNTGEITELAGC 240
Query  241  DYLTISPNLLEDLFNSTDAVPQKLNPAGAASLEIKKREYLNNEADFRFDFNEEAMGVEKL 300
            DYLTISPNLLEDL+NS + VP+KL+ + AASL+I+K+ Y+N+EA FRFDFNE+ M VEKL
Sbjct  241  DYLTISPNLLEDLLNSNEPVPKKLDASQAASLDIEKKSYINDEALFRFDFNEDQMAVEKL 300
Query  301  REGISKFAADAVTLKQLLAQKI 322
            REGISKFAADAVTLK +L +K+
Sbjct  301  REGISKFAADAVTLKSILKEKL 322

Sequence Alignment: 3. Allergen Name: Cla c 14.0101 Sequence ID: ADK47394

 Score = 367.3 bits 1583,  Expect = 5e-103
 Identities = 246/323 76%, Positives = 280/323 86%, Gaps = 0/323 0%
Query  1    MSSSLEQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAALIDTAVAYG 60
            MSSSL+QLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYA LID AVAYG
Sbjct  1    MSSSLDQLKASGTTVVCDSGDFATIGKYKPQDATTNPSLILAASKKPEYAKLIDDAVAYG 60
Query  61   KQNGKTLDEQVEATLDRLLVEFGKEILKIIPGKVSTEVDAKLSFDTQGSVNKALEIIKLY 120
             ++GKT +E+++AT+D LLV+FG EILKI+PGKVSTEVDA++SFD   S+ KAL II LY
Sbjct  61   MKHGKTTEEKIDATFDNLLVQFGSEILKIVPGKVSTEVDARFSFDKDVSIQKALRIIDLY 120
Query  121  ADNGISKDRVLIKIASTYEGIKAAHILQTQHGINCNLTLMFSLVQAIAAAEAGAYLISPF 180
             + GI K+RVLIK+AST+EGI+AAH LQT+HGINCNLTLMFSL QAIAAAEAGAYLISPF
Sbjct  121  KEAGIDKERVLIKLASTWEGIQAAHELQTKHGINCNLTLMFSLPQAIAAAEAGAYLISPF 180
Query  181  VGRILDWYKAAHKRDYTPQEDPGVKSVQDIYNYYKKFGYNTIVMGASFRNVGEITELAGC 240
            VGRILDWYKA  K++Y    DPGVKSV DI+NYYKK+ Y TIVMGASFRN+GEITELAGC
Sbjct  181  VGRILDWYKANTKQEYNASNDPGVKSVVDIFNYYKKYDYKTIVMGASFRNIGEITELAGC 240
Query  241  DYLTISPNLLEDLFNSTDAVPQKLNPAGAASLEIKKREYLNNEADFRFDFNEEAMGVEKL 300
            DYLTI+P LLE L+NSTDAVPQKL     A L+I+K+ YL +EA FRFDFNE+ M V KL
Sbjct  241  DYLTIAPALLEQLYNSTDAVPQKLKAEDVAKLDIEKKSYLKDEALFRFDFNEDPMAVNKL 300
Query  301  REGISKFAADAVTLKQLLAQKIQ 323
             EGISKFAADAVTLK +L +KI+
Sbjct  301  SEGISKFAADAVTLKDILREKIE 323

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.