The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSN
FKNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLA
MYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATA
LGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRV
LMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQ
LKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYGK
PLSYTLNQDEAIVRGCTLACATLSPVFRVREFSVHDISSYPIKVSWEPAPDVPDEENELV
VFNTNNPVPSTKILTFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEHSI
VKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDDLP
IVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATFVQ
SEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFRWKEHEERPKAAA
QLREVVNKYMSVFENEPEKYDHLSDDDKTKVIEKAATVGKWLDDYMYKQSELPKNVDPKL
TSEEILKKKDDVIYVCTPILTKPKPRVPVDTSKPEENAQTSNENEKQGDMDVD
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD20981 Mala s 10 773 5000 1145.8 0
AOD75395 Tyr p 28.0101 659 912 214.0 3.1e-56
AIO08848 Der f 28.0201 654 908 213.1 5.9e-56
QAT18639 Der p 28.0101 655 895 210.1 4.6e-55
P40918 Cla h 5.0101 643 858 201.7 1.6e-52
CAC14168 Cor a 10 668 853 200.6 3.6e-52
Q1HR69 Aed a 8.0101 655 817 192.3 1e-49
L7V065 Der f 28.0101 659 799 188.2 1.8e-48
Q92260 Pen c 19 503 625 148.6 1.1e-36
AAB48043 Alt a 3 117 128 36.5 0.0015
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mala s 10 Sequence ID: CAD20981

 Score = 1145.8 bits 5000,  Expect = 0
 Identities = 773/773 100%, Positives = 773/773 100%, Gaps = 0/773 0%
Query  1    MSSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSN 60
            MSSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSN
Sbjct  1    MSSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSN 60
Query  61   FKNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLA 120
            FKNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLA
Sbjct  61   FKNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLA 120
Query  121  MYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATA 180
            MYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATA
Sbjct  121  MYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATA 180
Query  181  LGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRV 240
            LGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRV
Sbjct  181  LGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRV 240
Query  241  LMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQ 300
            LMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQ
Sbjct  241  LMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQ 300
Query  301  LKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYGK 360
            LKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYGK
Sbjct  301  LKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYGK 360
Query  361  PLSYTLNQDEAIVRGCTLACATLSPVFRVREFSVHDISSYPIKVSWEPAPDVPDEENELV 420
            PLSYTLNQDEAIVRGCTLACATLSPVFRVREFSVHDISSYPIKVSWEPAPDVPDEENELV
Sbjct  361  PLSYTLNQDEAIVRGCTLACATLSPVFRVREFSVHDISSYPIKVSWEPAPDVPDEENELV 420
Query  421  VFNTNNPVPSTKILTFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEHSI 480
            VFNTNNPVPSTKILTFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEHSI
Sbjct  421  VFNTNNPVPSTKILTFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEHSI 480
Query  481  VKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDDLP 540
            VKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDDLP
Sbjct  481  VKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDDLP 540
Query  541  IVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATFVQ 600
            IVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATFVQ
Sbjct  541  IVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATFVQ 600
Query  601  SEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFRWKEHEERPKAAA 660
            SEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFRWKEHEERPKAAA
Sbjct  601  SEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFRWKEHEERPKAAA 660
Query  661  QLREVVNKYMSVFENEPEKYDHLSDDDKTKVIEKAATVGKWLDDYMYKQSELPKNVDPKL 720
            QLREVVNKYMSVFENEPEKYDHLSDDDKTKVIEKAATVGKWLDDYMYKQSELPKNVDPKL
Sbjct  661  QLREVVNKYMSVFENEPEKYDHLSDDDKTKVIEKAATVGKWLDDYMYKQSELPKNVDPKL 720
Query  721  TSEEILKKKDDVIYVCTPILTKPKPRVPVDTSKPEENAQTSNENEKQGDMDVD 773
            TSEEILKKKDDVIYVCTPILTKPKPRVPVDTSKPEENAQTSNENEKQGDMDVD
Sbjct  721  TSEEILKKKDDVIYVCTPILTKPKPRVPVDTSKPEENAQTSNENEKQGDMDVD 773

Sequence Alignment: 2. Allergen Name: Tyr p 28.0101 Sequence ID: AOD75395

 Score = 214.0 bits 912,  Expect = 3e-56
 Identities = 200/639 31%, Positives = 349/639 54%, Gaps = 55/639 8%
Query  2    SSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSNF 61
            +  +G+D+G + S +GV +   V+I++N+  NR+TPS V+F    RL+G+ A      N 
Sbjct  6    TPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 65
Query  62   KNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLAM 121
             NTV   KRLIGR F D S+Q   K + +  +V+  G+  ++V F+ E+  F   ++ +M
Sbjct  66   TNTVFDAKRLIGRRFDDASVQADMKHW-SFNVVNDDGKPKIEVEFKGEKKKFFPEEISSM 124
Query  122  YLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATAL 181
             L K+ +T +  LG + V+  V++VP +F D+QR+A   A  IA LN LR++NEPTA A+
Sbjct  125  VLTKMKETAEAYLGTT-VTSAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAI 183
Query  182  GYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRVL 241
             YG+ K    E    +NV+  D+G  ++ VS++    G + V     D ++GG +FD  L
Sbjct  184  AYGLDKKTQGE----KNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRL 239
Query  242  MEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQL 301
            + HF +EFK K+K D   N +A  RL   CER K+ LS++T A + ++SL   ID  S +
Sbjct  240  VNHFVQEFKRKHKKDPSDNKRALRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYSSI 299
Query  302  KRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWY-GK 360
             R  FE L A  +     P++ +L  + L K++IH + LVGGS+R+P +++ +  ++ GK
Sbjct  300  TRARFEELCADLFRSTLDPVEKSLRDAKLDKNQIHEIVLVGGSTRIPKIQKLLQDFFNGK 359
Query  361  PLSYTLNQDEAIVRGCTLACATLS--PVFRVREFSVHDISSYPIKVSWEPAPDVPDEENE 418
             L+ ++N DEA+  G  +  A L+      V++  + D++  P+ +  E A  V      
Sbjct  360  ELNKSINPDEAVAYGAAVQAAILNGDESSEVQQILLLDVA--PLSLGIETAGGV---MTA 414
Query  419  LVVFNTNNPVPSTKILTFYR-KEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGE 477
            L+  N+  P   T+ ++ Y   +P  L   Y     + K  N  LG+  +  + P  +G 
Sbjct  415  LIKRNSTIPTKQTQTFSTYSDNQPGVLIQVYEGERAMTKDNN-LLGKFELSGIPPAPRGV 473
Query  478  HSIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKD 537
              I +V   ++ +G+LNV +   VD+   ++    +  +    ++   E+ + +    +D
Sbjct  474  PQI-EVTFDIDANGILNVSA---VDKSTGKQNKITITNDKGRLSKEDIERMVKEAESYRD 529
Query  538  DLPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDER-YA 596
            +                + K+R       D++ A     +N LE Y +  +S ++E    
Sbjct  530  E----------------DEKQR-------DRITA-----RNTLESYAFQIKSSIEEEAIK 561
Query  597  TFVQSEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFRWKEHEERP 656
            + +  E+++K+L  + E+  WL  +    A K  +    + L+ V  PI  +  ++    
Sbjct  562  SKISEEDRKKILDKVEETMKWL--DSNALAEKDEFEHHRKELEAVCNPIMTKLYQQA--- 616
Query  657  KAAAQLREVVNKYMSVFENEPEKYDHLSDDDKTK 690
              AA    +   +   F       D  +DD K K
Sbjct  617  -GAAPGGGMPGGFPGGFPGATGAGDAPADDSKAK 649

Sequence Alignment: 3. Allergen Name: Der f 28.0201 Sequence ID: AIO08848

 Score = 213.1 bits 908,  Expect = 6e-56
 Identities = 201/606 33%, Positives = 338/606 55%, Gaps = 58/606 9%
Query  5    VGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSNFKNT 64
            +G+D+G + S +GV +   V+I++N+  NR+TPS V+F    RL+G+ A    + N  NT
Sbjct  11   IGIDLGTTYSCVGVFQNGSVEIIANDQGNRTTPSYVAFNDTERLIGDAAKNQVSMNPTNT 70
Query  65   VGSLKRLIGRTFQDESIQTYEK--PFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLAMY 122
            +   KRLIGR F + S+++  K  PF   ++V   G+  ++V F+ E   F   ++ AM 
Sbjct  71   IFDAKRLIGRRFDESSVKSDMKHWPF---KVVSESGKPKLEVEFKGERKRFWPEEISAMV 127
Query  123  LGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATALG 182
            L K+ +T +  LG   V+DVV++VP +F D+QR+A   A  IA LN LR++NEPTA A+ 
Sbjct  128  LTKMKETAEAYLG-QKVTDVVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA 186
Query  183  YGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRVLM 242
            YG+ K    E    +NV+  D+G  ++ VSV+    G + V     D ++GG +FD  L+
Sbjct  187  YGLDKKGGGE----KNVLIFDLGGGTFDVSVLTIDNGIFEVKSTAGDTHLGGEDFDNRLV 242
Query  243  EHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQLK 302
             HF +EFK K+  D+  N +A  RL   CER K+ LS++T   + ++SL   ID  S + 
Sbjct  243  NHFVQEFKRKFGKDIMSNKRALRRLRTSCERAKRTLSSSTQTSIEIDSLHEGIDFYSTIT 302
Query  303  RDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWY-GKP 361
            R  FE L +  +     P++ AL  + L K +I  + LVGGS+R+P +++ ++ ++ GK 
Sbjct  303  RARFEELCSDLFRSTLEPVEKALRDAKLDKSKIDEIVLVGGSTRIPKIQKLLSDFFNGKE 362
Query  362  LSYTLNQDEAIVRGCTLACATLSP--VFRVREFSVHDISSYPIKVSWEPAPDVPDEENEL 419
            L+ ++N DEA+  G  +  A L+      V+++ + D++  P+ +  E A  V      L
Sbjct  363  LNKSINPDEAVAYGAAVQAAILTGDNSNNVKDLLLLDVA--PLSLGIETAGGV---MTTL 417
Query  420  VVFNTNNPVPSTKILTFYR-KEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEH 478
            +  NT  P   T+ +T Y   +P      Y     + K  N  LG   +  + P  +G  
Sbjct  418  IKRNTTIPTKQTQTFTTYADNQPAVTIQVYEGERAMTKDNNR-LGTFDLTGIPPAPRGVP 476
Query  479  SIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDD 538
             I +V   ++ +G+LNV SA  VD+    +    +  +    ++   EK + +  Q ++D
Sbjct  477  QI-EVTFDVDANGILNV-SA--VDKSTGRQNKITITNDKGRLSKADIEKMVQEAEQYRED 532
Query  539  LPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATF 598
                               ER+ +  AA          KN LE Y +  +S ++E     
Sbjct  533  ------------------DERQRERIAA----------KNQLEAYAFQLKSTMEEEAVKS 564
Query  599  VQSEEKEK-LLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIH---FRWKEHEE 654
              SEE  K +L  + E+  WL + +  D  K  +  R + ++    PI    ++ ++++ 
Sbjct  565  KLSEEDRKTVLNKVDETLRWLDSNQLAD--KEEFEHRQKEIENACRPIMMKIYQQQQQQH 622
Query  655  RPKA 658
             P A
Sbjct  623  HPGA 626

Sequence Alignment: 4. Allergen Name: Der p 28.0101 Sequence ID: QAT18639

 Score = 210.1 bits 895,  Expect = 5e-55
 Identities = 200/606 33%, Positives = 333/606 54%, Gaps = 56/606 9%
Query  5    VGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSNFKNT 64
            +G+D+G + S +GV +   V+I++N+  NR+TPS V+F    RL+G+ A      N  NT
Sbjct  11   IGIDLGTTYSCVGVFQNGSVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANT 70
Query  65   VGSLKRLIGRTFQDESIQTYEK--PFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLAMY 122
            +   KRLIGR F + S+++  K  PF   ++V   G+  ++V F+ E+  F   ++ AM 
Sbjct  71   IFDAKRLIGRRFDEPSVKSDMKHWPF---KVVSESGKPKIEVEFKGEQKRFWPEEVSAMV 127
Query  123  LGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATALG 182
            L K+ +T +  LG   V+D V++VP +F D+QR+A   A  IA LN LR++NEPTA A+ 
Sbjct  128  LTKMKETAEAYLG-QKVTDAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA 186
Query  183  YGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRVLM 242
            YG+ K    E    +NV+  D+G  ++ VSV+    G + V     D ++GG +FD  L+
Sbjct  187  YGLDKKGGGE----KNVLIFDLGGGTFDVSVLTIDNGIFEVKSTAGDTHLGGEDFDNRLV 242
Query  243  EHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQLK 302
             HF +EFK K+  D+  N +A  RL   CER K+ LS++T   + ++SL    D  S + 
Sbjct  243  NHFVQEFKRKFGKDIMSNKRALRRLRTACERAKRTLSSSTQTTIEIDSLHEGTDFYSTIT 302
Query  303  RDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWY-GKP 361
            R  FE L +  +     P++ AL  + L K +I  + LVGGS+R+P +++ ++ ++ GK 
Sbjct  303  RARFEELCSDLFRSTLEPVEKALRDAKLDKSKIDEIVLVGGSTRIPKIQKLLSDFFNGKE 362
Query  362  LSYTLNQDEAIVRGCTLACATLS--PVFRVREFSVHDISSYPIKVSWEPAPDVPDEENEL 419
            L+ ++N DEA+  G  +  A L+      V+++ + D++  P+ +  E A  V      L
Sbjct  363  LNKSINPDEAVAYGAAVQAAILTGDTSNNVKDLLLLDVA--PLSLGIETAGGV---MTTL 417
Query  420  VVFNTNNPVPSTKILTFYR-KEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEH 478
            +  NT  P   T+ +T Y   +P      Y     + K  N  LG   +  + P  +G  
Sbjct  418  IKRNTTIPTKQTQTFTTYADNQPAVTIQVYEGERAMTKDNNR-LGTFDLTGIPPAPRGVP 476
Query  479  SIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDD 538
             I +V   ++ +G+LNV SA              VD                K   R++ 
Sbjct  477  QI-EVTFDVDANGILNV-SA--------------VD----------------KSTGRQNK 504
Query  539  LPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATF 598
            + I +  G L    + ++     Q    D+   +    KN LE Y +  +S ++E     
Sbjct  505  ITITNDKGRLSKADIEKMVNEAEQYREEDERQRERISAKNQLEAYAFQLKSTMEEEAIKS 564
Query  599  VQSEEKEK-LLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFR-WKEHEERP 656
              SEE  K +L  + E+  WL + +  D  K  Y  R + L+    PI  + ++++++ P
Sbjct  565  KLSEEDRKTVLNKVEETLRWLDSNQLAD--KEEYEHRQKELESACRPIMTKIYQQQQQHP 622
Query  657  KA 658
             A
Sbjct  623  GA 624

Sequence Alignment: 5. Allergen Name: Cla h 5.0101 Sequence ID: P40918

 Score = 201.7 bits 858,  Expect = 2e-52
 Identities = 190/601 31%, Positives = 325/601 54%, Gaps = 54/601 8%
Query  1    MSSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSN 60
            M+  +G+D+G + S +G+ R   ++I++N+  NR+TPS+V+F    RL+G+ A      N
Sbjct  1    MAPAIGIDLGTTYSCVGIYRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDSAKNQVAIN 60
Query  61   FKNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQNEEHIFSATQLLA 120
              NTV   KRLIGR FQD  +Q   K F   ++++  G+   +V F+ E   F+  ++ +
Sbjct  61   PHNTVFDAKRLIGRKFQDAEVQADMKHF-PFKVIEKAGKPVTQVEFKGETKDFTPEEISS 119
Query  121  MYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATA 180
            M L K+ +T ++ LGG+ V++ V++VP +F D+QR+A   A  IA LN LR++NEPTA A
Sbjct  120  MILTKMRETAESYLGGT-VNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAA 178
Query  181  LGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRV 240
            + YG+ K    + +  +NV+  D+G  ++ VS +   +G + V     D ++GG +FD  
Sbjct  179  IAYGLDK----KQEGEKNVLIFDLGGGTFDVSFLTIEEGIFEVKSTAGDTHLGGEDFDNR 234
Query  241  LMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQ 300
            L+ HF+ EFK K+K D+  N +A  RL   CER K+ LS++    + ++SL   ID  + 
Sbjct  235  LVNHFSNEFKRKHKKDLSDNARALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFFTS 294
Query  301  LKRDEFESLIAPYLERVNG-PLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWY- 358
              R  FE  +   L R N  P +  L    + K  +H + L GGS+R+P +++ ++ ++ 
Sbjct  295  NTRARFEE-VGQDLFRGNMEPGERTLRDDKIDKSSVHEIVLGGGSTRIPKVQKLVSDFFN 353
Query  359  GKPLSYTLNQDEAIVRGCTLACATLS---PVFRVREFSVHDISSYPIKVSWEPAPDVPDE 415
            GK    ++N DEA+  G  +  A LS        +E  + D++  P+ +  E A  V   
Sbjct  354  GKEPCKSINPDEAVAYGAAVQAAILSGDTSSKSTKEILLLDVA--PLSLGIETAGGV--- 408
Query  416  ENELVVFNTNNPVPSTKIL-TFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNE 474
               L+  NT  P   ++ + TF   +P  L   +       K  N  +G+  +  + P  
Sbjct  409  MTALIKRNTTIPTKKSETFSTFSDNQPGVLIQVFEGERARTKDIN-LMGKFELSGIRPAP 467
Query  475  KGEHSIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQ 534
            +G   I +V   L+ +G++NV                    +A E    KT K +     
Sbjct  468  RGVPQI-EVTFDLDANGIMNV--------------------SALEKGTGKTNKIV----- 501
Query  535  RKDDLPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKL-DE 593
                  I +  G L    +  +     +    D+  A     KN LE Y Y  ++ + D 
Sbjct  502  ------ITNDKGRLSKEEIERMLADAEKYKEEDEAEAGRIQAKNGLESYAYSLKNTVSDP 555
Query  594  RYATFVQSEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPIHFR 648
            +    + +E+KE L   + ++  W+  +E + ATK  Y +  + L+ V  P+  +
Sbjct  556  KVEEKLSAEDKETLTGAIDKTVAWI--DENQTATKEEYEAEQKQLESVANPVMMK 608

Sequence Alignment: 6. Allergen Name: Cor a 10 Sequence ID: CAC14168

 Score = 200.6 bits 853,  Expect = 4e-52
 Identities = 183/598 30%, Positives = 343/598 57%, Gaps = 54/598 9%
Query  1    MSSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSN 60
            + +V+G+D+G + S +GV +   V+I++N+  NR TPS V F    RL+GE A      N
Sbjct  35   LGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVN 94
Query  61   FKNTVGSLKRLIGRTFQDESIQTYEKPFVNAELVDAKGEVGVKVRFQN-EEHIFSATQLL 119
             + T+  +KRLIGR F+D+ +Q   K +V  ++V+  G+  ++V+ ++ E  +FS  ++ 
Sbjct  95   PERTIFDVKRLIGRKFEDKEVQKDMK-LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEIS 153
Query  120  AMYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTAT 179
            AM L K+ +T +  LG   + D V++VP +F DAQR+A   A  IA LN  R++NEPTA 
Sbjct  154  AMILIKMKETAEAFLGKK-IKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAA 212
Query  180  ALGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDR 239
            A+ YG+ K         +N++  D+G  ++ VS++    G + VL    D ++GG +FD 
Sbjct  213  AIAYGLDKKG-----GEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDM 267
Query  240  VLMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAAS 299
             +ME+F +  K K+  D+  + +A  +L    ER K+ LS+    ++ +ESL + +D + 
Sbjct  268  RIMEYFIKLIKKKHGKDISKDNRAIGKLRREAERAKRALSSQHQVRVEIESLFDGVDFSE 327
Query  300  QLKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWY- 358
             L R  FE L   ++++ +G  + A+  +GL K++I  + LVGGS+R+P +++ +  ++ 
Sbjct  328  PLTRARFEELNNDFVQKDHGTREEAMEDAGLAKNQIDEIVLVGGSTRIPKVQQLLKDYFD 387
Query  359  GKPLSYTLNQDEAIVRGCTLACATLSPV--FRVREFSVHDISSYPIKVSWEPAPDVPDEE 416
            GK  +  +N DEA+  G  +  + LS       ++  + D++  P+ +  E    V    
Sbjct  388  GKEPNKGVNPDEAVAYGAAVQGSILSGEGGEETKDILLLDVA--PLTLGIETVGGV---M 442
Query  417  NELVVFNTNNPVPSTKILTFYRKEPFSLDA-TYADASTLPKGTNPWLGRVTIKNVAPNEK 475
             +L+  NT  P   ++++T Y+ +  ++    +    +L K     LG+  +  V P  +
Sbjct  443  TKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRN-LGKFDLTGVPPAPR 501
Query  476  GEHSIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQR 535
            G   I +V   ++ +G+LNV+                     AED          K   +
Sbjct  502  GTPQI-EVTFEVDANGILNVK---------------------AED----------KGTGK 529
Query  536  KDDLPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDER- 594
             + + I +  G L    +  + +   +    DK V +  D +N LE Y+Y+ +++++++ 
Sbjct  530  SEKITITNDKGRLSQEEIDRMVQEAEEFAEEDKKVKERIDARNTLETYVYNMKNQVNDKD 589
Query  595  -YATFVQSEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPI 645
              A  ++S+EK+K+ + + ++ +WL  ++ + A K  Y  +L+ ++ V  PI
Sbjct  590  KLADKLESDEKDKIESAVKDALEWL--DDNQSAEKEDYDEKLKEVEAVCNPI 639

Sequence Alignment: 7. Allergen Name: Aed a 8.0101 Sequence ID: Q1HR69

 Score = 192.3 bits 817,  Expect = 1e-49
 Identities = 187/593 31%, Positives = 323/593 54%, Gaps = 58/593 9%
Query  3    SVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSF-GQKARLLGEGAATAQTSNF 61
            +VVG+D+G + S +GV +   V+I++N+  NR TPS V+F     RL+G+ A    T+N 
Sbjct  30   TVVGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89
Query  62   KNTVGSLKRLIGRTFQDESIQTYEK--PFVNAELVDAKGEVGVKVRFQNEEHIFSATQLL 119
            +NTV   KRLIGR F D ++Q   K  PF   ++++   +  +KV     + +F+  ++ 
Sbjct  90   ENTVFDAKRLIGREFTDSTVQHDAKLLPF---KVIEKNSKPHIKVSTSQGDKVFAPEEIS 146
Query  120  AMYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTAT 179
            AM LGK+ +T +  LG   V+  V++VP +F DAQR+A   A  IA LN +R++NEPTA 
Sbjct  147  AMVLGKMKETAEAYLGKK-VTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAA 205
Query  180  ALGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDR 239
            A+ YG+ K      D  +NV+  D+G  ++ VS++    G + V+    D ++GG +FD+
Sbjct  206  AIAYGLDK-----KDGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQ 260
Query  240  VLMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAAS 299
             +M+HF + +K K   D+  + +A  +L    E+ K+ LS++   ++ +ES+    D + 
Sbjct  261  RVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSSSHQVRIEIESFYEGDDFSE 320
Query  300  QLKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWY- 358
             L R +FE L    +     P+   L  + + K ++  + LVGGS+R+P +++ +  ++ 
Sbjct  321  TLTRAKFEELNMDLFRSTMKPVQKVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFN 380
Query  359  GKPLSYTLNQDEAIVRGCTLACATLSPVFRVREFSVHDISSYPIKVSWEPAPDVPDEENE 418
            GK  S  +N DEA+  G  +    LS         + D++  P+ +  E    V     +
Sbjct  381  GKEPSRGINPDEAVAYGAAVQAGVLSGEQDTEAIVLLDVN--PLTMGIETVGGV---MTK 435
Query  419  LVVFNTNNPVPSTKILTFYRKEPFSLDA-TYADASTLPKGTNPWLGRVTIKNVAPNEKGE 477
            L+  NT  P   ++I++       ++    Y     + K  N  LG+  +  + P  +G 
Sbjct  436  LIPRNTVIPTKKSQIFSTASDNQHTVTIQVYEGERPMTKD-NHLLGKFDLTGIPPAPRGI 494
Query  478  HSIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQR-K 536
              I +V   ++ +G+L V SA       +E+ V   D N      P+  ++++K  +R  
Sbjct  495  PQI-EVSFEIDANGILQV-SAEDKGTGNREKIVITNDQNRLT---PEDIERMIKDAERFA 549
Query  537  DDLPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDER-- 594
            DD          D     +LKER              E R N LE Y Y  +++L ++  
Sbjct  550  DD----------D----KKLKER-------------VEAR-NELESYAYSLKNQLGDKDK 581
Query  595  YATFVQSEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPI 645
                V  ++K  +   + E   WL  +E +DA    Y  + + L+ V  PI
Sbjct  582  LGAKVADDDKATMEEAIDEKIKWL--DENQDADSEDYKKQKKELEDVVQPI 630

Sequence Alignment: 8. Allergen Name: Der f 28.0101 Sequence ID: L7V065

 Score = 188.2 bits 799,  Expect = 2e-48
 Identities = 175/558 31%, Positives = 301/558 53%, Gaps = 63/558 11%
Query  2    SSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSNF 61
            +  +G+D+G + S +GV +   V+I++N+  NR+TPS V F    RL+G+ A      N 
Sbjct  4    TPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNP 63
Query  62   KNTVGSLKRLIGRTFQDESIQTYEK--PFVNAELVDAKGEVGVKVRFQNEEHIFSATQLL 119
             NTV   KRLIGR F + ++Q   K  PF   ++++   +  ++V F+ E   F   ++ 
Sbjct  64   SNTVFDAKRLIGRKFDETTVQADMKHWPF---KVIEKGNKPAIEVEFKGETKQFIPEEIS 120
Query  120  AMYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTAT 179
            +M L K+ +T +  LGG+ V++ V++VP +F D+QR+A   +  IA LN LR++NEPTA 
Sbjct  121  SMVLVKMRETAEAYLGGT-VNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAA 179
Query  180  ALGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDR 239
            A+ YG+ K         RNV+  D+G  ++ VS++   +G + V     D ++GG +FD 
Sbjct  180  AIAYGLDKKG---GAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDN 236
Query  240  VLMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAAS 299
             L+ HF +EFK K+K D+  N +A  RL   CER K+ LS+     + ++SL   ID  +
Sbjct  237  RLVNHFVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYT 296
Query  300  QLKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYG 359
             + R  FE L A  +     P++  L  +   K  ++ + LVGGS+R+P ++  +A ++ 
Sbjct  297  SITRARFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN 356
Query  360  KPLSYTLNQDEAIVRGCTLACATLSPVFRVR---EFSVHDISSYPIKVSWEPAPDVPDE- 415
            K  + ++N DEAI  G  +  + LS     +   E  + D++  P+ +  E A  V    
Sbjct  357  KDPNKSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVA--PLSLGIETAGGVMTAL 414
Query  416  -ENELVVFNTNN----PVPSTKILTFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNV 470
             + +  +   +     P P+T +++ +R    S+ A     ++L   ++P        + 
Sbjct  415  IKRDTTIPTRSPRLSLPTPTTSLVSRFRSTRVSVLAPRT-TTSLVSSSSPV---SPCSSW 470
Query  471  APNEKGEHSIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIV 530
              +++G   +       + +G++NV                     A E    KT K   
Sbjct  471  CSSDRGHFDV-------DANGIMNV--------------------GAVEKGTGKTNK--- 500
Query  531  KKLQRKDDLPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSK 590
                    + I +  G L    +  +     +  A D+  A     KN  E Y Y  R+ 
Sbjct  501  --------ITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKNGPESYAYSLRNT 552
Query  591  LDERYATFVQSEEKEKLLAML 611
            ++E   +   S+ KEKL A L
Sbjct  553  VNEGKLSISDSD-KEKLRARL 572

Sequence Alignment: 9. Allergen Name: Pen c 19 Sequence ID: Q92260

 Score = 148.6 bits 625,  Expect = 1e-36
 Identities = 143/466 30%, Positives = 247/466 53%, Gaps = 50/466 10%
Query  134  LGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTATALGYGITKTDLPEP 193
            LGG+ V++ V++VP +F D+QR+A   A  IA LN LR++NEPTA A+ YG+ K    + 
Sbjct  3    LGGT-VNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDK----KT 57
Query  194  DSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDRVLMEHFAEEFKGKY 253
            +  RNV+  D+G  ++ VS++   +G + V     D ++GG +FD  L+ HF  EFK K+
Sbjct  58   EGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVNEFKRKH 117
Query  254  KIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAASQLKRDEFESLIAPY 313
            K D+  N +A  RL   CER K+ LS+     + ++SL   ID  + + R  FE L    
Sbjct  118  KKDLTTNARALRRLRTACERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFEELCQDL 177
Query  314  LERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYGKPLSYTLNQDEAIV 373
            +     P++  L  + + K  +H + LVGGS+R+P +++ ++ ++ K  + ++N DEA+ 
Sbjct  178  FRGTMEPVERVLRDAKIDKSSVHEIVLVGGSTRIPKIQKLVSDFFNKDANKSINPDEAVA 237
Query  374  RGCTLACATLSPVFRVR---EFSVHDISSYPIKVSWEPAPDVPDEENELVVFNTNNPVPS 430
             G  +  A LS     +   E  + D++  P+ +  E A  V      L+  NT  P   
Sbjct  238  YGAAVQAAILSGDTSSKSTNEILLLDVA--PLSLGIETAGGV---MTPLIKRNTTIPTKK 292
Query  431  TKILTFYR-KEPFSLDATYADASTLPKGTNPWLGRVTIKNVAPNEKGEHSIVKVKARLNL 489
            ++ ++ Y   +P  L   +       K  N  LG+  +  + P  +G   I +V   L+ 
Sbjct  293  SETFSTYSDNQPGVLIQVFEGERARTKDNN-LLGKFELTGIPPAPRGVPQI-EVTFDLDA 350
Query  490  HGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIVKKLQRKDDLPIVSGIGLLD 549
            +G++NV                    +A+E    K+ K           + I +  G L 
Sbjct  351  NGIMNV--------------------SASEKGTGKSNK-----------ITITNDKGRLS 379
Query  550  PTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSKLDERYATFVQSEEKEKLLA 609
               +  +     +  A D+  A     KN LE Y Y  ++ + E     +  ++K+K+  
Sbjct  380  KEEIERMLAEAEKYKAEDEAEASRIQAKNGLESYAYSLKNTITEGKLQ-MSDDDKKKIED 438
Query  610  MLAESEDWLYTEEGEDATKSAYVSRLETLQKVGAPI 645
             ++E   WL  +  + A K  Y S+ + L+ +  PI
Sbjct  439  KISEIISWL--DNNQTAEKDEYESQQKELEAIANPI 472

Sequence Alignment: 10. Allergen Name: Alt a 3 Sequence ID: AAB48043

 Score = 36.5 bits 128,  Expect = 0.002
 Identities = 25/71 35%, Positives = 42/71 59%, Gaps = 3/71 4%
Query  577  KNALEEYIYDTRSKL-DERYATFVQSEEKEKLLAMLAESEDWLYTEEGEDATKSAYVSRL 635
            KNALE Y Y  R+ L D +    + + +K+KL A + ++  WL  ++ + ATK  Y S+ 
Sbjct  8    KNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWL--DDNQTATKDEYESQQ 65
Query  636  ETLQKVGAPIHFRW 649
            + L+ V  PI  ++
Sbjct  66   KELEGVANPIMMKF 79

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.