The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL
LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD
Sequence Info Allergen Name Length Opt Bits Score E Value
P49148 Alt a 12 110 691 188.2 4.5e-50
P50344 Cla h 12 110 497 137.3 9.4e-35
AEX34122 Pen cr 26.0101 107 463 128.4 4.3e-32
AAX11194 Pen b 26.0101 107 460 127.6 7.5e-32
Q9UUZ6 Asp f 8 111 218 64.1 1e-12
P42039 Cla h 10.0101 111 199 59.1 3.2e-11
P42039 Cla h 5.0101 111 194 57.8 8e-11
CAA55067 Cla h 5.0101 111 194 57.8 8e-11
AAB48041 Alt a 6 113 173 52.3 3.7e-09
P42037 Alt a 6 113 171 51.7 5.4e-09
AAL79930 Fus c 1 109 170 51.5 6.1e-09
Q8H2B9 Pru du 5.0101 113 148 45.7 3.5e-07
AAK00899 Cul n 1 78 104 34.5 0.00057
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Alt a 12 Sequence ID: P49148

 Score = 188.2 bits 691,  Expect = 5e-50
 Identities = 110/110 100%, Positives = 110/110 100%, Gaps = 0/110 0%
Query  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
            MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL
Sbjct  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
Query  61   LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
            LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD
Sbjct  61   LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110

Sequence Alignment: 2. Allergen Name: Cla h 12 Sequence ID: P50344

 Score = 137.3 bits 497,  Expect = 9e-35
 Identities = 81/110 73%, Positives = 91/110 82%, Gaps = 0/110 0%
Query  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
            MS +ELA+SYAALILAD+G++ITADKLQ+LI AAK+ E+EPIWT+LFAKALEGKDVKDLL
Sbjct  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
Query  61   LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
            LNVGSGGGAAP          AA     AEEK EEEKEESD+DMGFGLFD
Sbjct  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110

Sequence Alignment: 3. Allergen Name: Pen cr 26.0101 Sequence ID: AEX34122

 Score = 128.4 bits 463,  Expect = 4e-32
 Identities = 75/105 71%, Positives = 90/105 85%, Gaps = 7/105 6%
Query  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
            MST+ELA SYAALILADDG++I+ADK+Q+LI AA ++EVEPIW ++FA+ALEGKD+K+LL
Sbjct  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
Query  61   LNVGSGGGAAPLPEALLLRWRAADAAPAAE--EKKEEEKEESDEDMGFGLFD 110
             NVGS G A+  P        A  AAPA E  E+KEEEKEESDEDMGFGLFD
Sbjct  61   TNVGSAGPASAAPAGA-----AGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107

Sequence Alignment: 4. Allergen Name: Pen b 26.0101 Sequence ID: AAX11194

 Score = 127.6 bits 460,  Expect = 7e-32
 Identities = 76/104 73%, Positives = 92/104 88%, Gaps = 9/104 8%
Query  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
            MST+ELA SYAALILADDG++++ADK+Q+++ AAK++EVEPIW T+FAKALEGKD+K++L
Sbjct  1    MSTAELAVSYAALILADDGIEVSADKIQTILGAAKVQEVEPIWATIFAKALEGKDIKEIL 60
Query  61   LNVGSGGGA-APLPEALLLRWRAADAAPAAEEK--KEEEKEESDEDMGFGLFD 110
             NVGS G A A  P A      A  AAPA E+K  KEEEKEESDEDMGFGLFD
Sbjct  61   TNVGSAGPATAGAPAA------AGAAAPAEEKKEEKEEEKEESDEDMGFGLFD 107

Sequence Alignment: 5. Allergen Name: Asp f 8 Sequence ID: Q9UUZ6

 Score = 64.1 bits 218,  Expect = 1e-12
 Identities = 49/98 50%, Positives = 66/98 67%, Gaps = 10/98 10%
Query  11   AALILADDG-VDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LLN 62
            A L+LA  G    +++ +++++ +  I+  E     L A+ LEGKD+++L       L +
Sbjct  6    AFLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAE-LEGKDLQELIAEGSTKLAS 64
Query  63   VGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
            V SGG AA  P A       A AAPAA+EK EEEKEESDEDMGFGLFD
Sbjct  65   VPSGGAAAAAPAAAGAAAGGA-AAPAAKEKNEEEKEESDEDMGFGLFD 111

Sequence Alignment: 6. Allergen Name: Cla h 10.0101 Sequence ID: P42039

 Score = 59.1 bits 199,  Expect = 3e-11
 Identities = 46/98 46%, Positives = 65/98 66%, Gaps = 12/98 12%
Query  9    SYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LL 61
            +Y  L LA +    +A+ +++++ +  I+  E   ++L+ K LEGKD+ +L       L 
Sbjct  6    AYLLLGLAGNS-SPSAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSQKLA 63
Query  62   NVGSGG-GAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
            +V SGG GAAP          A +AAP  E  KEEEKEESD+DMGFGLFD
Sbjct  64   SVPSGGSGAAPSAGGAAAAGGATEAAP--EAAKEEEKEESDDDMGFGLFD 111

Sequence Alignment: 7. Allergen Name: Cla h 5.0101 Sequence ID: P42039

 Score = 57.8 bits 194,  Expect = 8e-11
 Identities = 40/86 46%, Positives = 58/86 67%, Gaps = 9/86 10%
Query  23   TADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LLNVGSGGGAAPLPEA 75
            +A+ +++++ +  I+  E   ++L+ K LEGKD+ +L       L +V SGG  A     
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSEKLASVPSGGAGAASAGG 77
Query  76   LLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
                  AA+AAP AE + EEEKEESD+DMGFGLFD
Sbjct  78   AAAAGGAAEAAPEAE-RAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 8. Allergen Name: Cla h 5.0101 Sequence ID: CAA55067

 Score = 57.8 bits 194,  Expect = 8e-11
 Identities = 40/86 46%, Positives = 58/86 67%, Gaps = 9/86 10%
Query  23   TADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LLNVGSGGGAAPLPEA 75
            +A+ +++++ +  I+  E   ++L+ K LEGKD+ +L       L +V SGG  A     
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSEKLASVPSGGAGAASAGG 77
Query  76   LLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
                  AA+AAP AE + EEEKEESD+DMGFGLFD
Sbjct  78   AAAAGGAAEAAPEAE-RAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 9. Allergen Name: Alt a 6 Sequence ID: AAB48041

 Score = 52.3 bits 173,  Expect = 4e-09
 Identities = 43/99 43%, Positives = 59/99 59%, Gaps = 10/99 10%
Query  11   AALILADDG-VDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LLN 62
            A L+L   G    +A  +++++++  IE        L ++ LEGKD+ +L       L +
Sbjct  6    AYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISE-LEGKDINELIASGPEKLAS 64
Query  63   VGSGG-GAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
            V SGG G A           +A+A  A E  KEEEKEESDEDMGFGLFD
Sbjct  65   VPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 10. Allergen Name: Alt a 6 Sequence ID: P42037

 Score = 51.7 bits 171,  Expect = 5e-09
 Identities = 43/99 43%, Positives = 58/99 58%, Gaps = 10/99 10%
Query  11   AALILADDG-VDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LLN 62
            A L+L   G    +A  +++++++  IE        L ++ LEGKD+ +L       L +
Sbjct  6    AYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISE-LEGKDINELIASGSEKLAS 64
Query  63   VGSGG-GAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110
            V SGG G A           +A A  A E  KEEEKEESDEDMGFGLFD
Sbjct  65   VPSGGAGGAAASGGAAAAGGSAQAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 11. Allergen Name: Fus c 1 Sequence ID: AAL79930

 Score = 51.5 bits 170,  Expect = 6e-09
 Identities = 45/94 47%, Positives = 58/94 61%, Gaps = 16/94 17%
Query  2    STSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLLL 61
            +TS  A    A +L   G+D   D+L  LI   + ++++     L A   EG + K   +
Sbjct  15   NTSPSAADVKA-VLTSVGIDADEDRLNKLISELEGKDIQQ----LIA---EGSE-KLASV 65
Query  62   NVGSGGGAAPLPEALLLRWRAADAAPAA-EEKKEEEKEESDEDMGFGLFD 110
              G  GGA+    A      A  AA  A EE+KEEEKEESDEDMGFGLFD
Sbjct  66   PSGGAGGASGGAAA------AGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109

Sequence Alignment: 12. Allergen Name: Pru du 5.0101 Sequence ID: Q8H2B9

 Score = 45.7 bits 148,  Expect = 4e-07
 Identities = 45/94 47%, Positives = 63/94 67%, Gaps = 21/94 22%
Query  11   AALILADDGVDIT--ADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LL 61
            AA +LA  G + T  A+ L+ ++ +   E  +     L+   ++GKD+ +L       L 
Sbjct  5    AAYLLAVLGGNTTPSAEDLKDILGSVGAE-TDDDRIQLLLSEVKGKDITELIASGREKLA 63
Query  62   NVGSGGGAAPL--PEALLLRWRAADAAPAAEE-KKEE---EKEESDEDMGFGLFD 110
            +V SGGGA  +  P A      A  AAPAA E KKEE   EKE++D+DMGF LFD
Sbjct  64   SVPSGGGAVAVAAPGA-----GAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD 113

Sequence Alignment: 13. Allergen Name: Cul n 1 Sequence ID: AAK00899

 Score = 34.5 bits 104,  Expect = 0.0006
 Identities = 20/28 71%, Positives = 24/28 85%, Gaps = 7/28 25%
Query  82   AADAAPAAEEKKEEEKEE-------SDEDMGFGLF 109
            AA  APAAE KKEE+KEE       SD+D+G+ LF
Sbjct  43   AAATAPAAETKKEEKKEEKKEETEESDDDIGLSLF 77

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.