The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL
APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE
RLGDYLFDQGF
Sequence Info Allergen Name Length Opt Bits Score E Value
AF377948 Mus a 1.0101 131 907 260.6 9.6e-72
Q9M7N0 Hev b 8.0201 131 790 227.8 7.6e-62
Q9LEI8 Hev b 8.0204 131 786 226.6 1.7e-61
AAL07320 Lit c 1 131 784 226.1 2.5e-61
Q9FR39 Zea m 12.0105 131 784 226.1 2.5e-61
Q9M7M8 Hev b 8.0203 131 778 224.4 7.9e-61
Q9XF38 Pyr c 4 131 776 223.8 1.2e-60
AAK54835 Ana c 1 131 776 223.8 1.2e-60
O22655 Zea m 12.0104 131 774 223.3 1.7e-60
Q9M7M9 Hev b 8.0202 131 773 223.0 2.1e-60
A0A2I4DNN6 Jug r 7.0101 131 770 222.1 3.8e-60
FM164277 Tri a 12.0104 131 766 221.0 8.2e-60
O65809 Gly m 3 131 766 221.0 8.2e-60
QID21357 Pop n 2.0101 131 763 220.2 1.5e-59
CAD37202 Pru p 4.0201 131 761 219.6 2.2e-59
P49233 Tri a 12.0102 141 761 219.6 2.4e-59
CAD37201 Pru p 4.0101 131 760 219.3 2.6e-59
AAL92870 Che a 2 131 759 219.0 3.2e-59
Q9XF40 Mal d 4 131 759 219.0 3.2e-59
O65810 Gly m 3 131 759 219.0 3.2e-59
P49234 Tri a 12.0103 140 759 219.0 3.5e-59
Q9XF42 Mal d 4 131 758 218.8 3.9e-59
Q8L5D8 Pho d 2.0101 131 756 218.2 5.8e-59
Q9AXH4 Cor a 2 131 756 218.2 5.8e-59
Q9XF37 Api g 4 134 755 217.9 7.2e-59
Q9XF41 Mal d 4 131 754 217.6 8.5e-59
AY081852 Pru du 4.0102 131 754 217.6 8.5e-59
AY081850 Pru du 4.0101 131 754 217.6 8.5e-59
Q9XF39 Pru av 4 131 753 217.4 1e-58
P52184 Hor v 12.0101 131 753 217.4 1e-58
Q9STB6 Hev b 8.0102 131 752 217.1 1.3e-58
O04725 Cyn d 12 131 751 216.8 1.5e-58
P49232 Tri a 12.0101 138 751 216.8 1.6e-58
P35081 Zea m 12.0101 131 750 216.5 1.9e-58
Q9FUD1 Ory s 12.0101 131 747 215.7 3.3e-58
Q5XWE1 Citr l 2.0101 131 746 215.4 4e-58
AAL29690 Lyc e 1 131 742 214.3 8.8e-58
AAK01235 Cor a 2 131 740 213.7 1.3e-57
AAP13533 Cuc m 2 131 738 213.1 1.9e-57
Q5EF31 Cro s 1.0101 131 737 212.9 2.3e-57
P84177 Cit s 2.0101 131 737 212.9 2.3e-57
O49894 Mer a 1 133 737 212.9 2.4e-57
CAD10376 Cap a 2 131 735 212.3 3.4e-57
P35083 Zea m 12.0103 131 734 212.0 4.2e-57
P35082 Zea m 12.0102 131 734 212.0 4.2e-57
AAL76933 Dau c 4 134 732 211.4 6.4e-57
QVU02258 Que ac 2.0101 133 730 210.9 9.3e-57
O24170 Ole e 2 134 727 210.0 1.7e-56
XP030492464 Can s 2.0101 133 726 209.8 2e-56
O24650 Phl p 12.0102 131 724 209.2 2.9e-56
O65812 Hev b 8.0101 131 724 209.2 2.9e-56
P25816 Bet v 2 133 724 209.2 3e-56
O24169 Ole e 2 134 724 209.2 3e-56
Q9SQI9 Ara h 5 131 722 208.6 4.3e-56
O24171 Ole e 2 134 722 208.6 4.5e-56
ACP43298 Ama r 2.0101 133 719 207.8 7.9e-56
CAA54686 Phl p 12.0101 131 717 207.2 1.1e-55
P35079 Phl p 12.0101 131 717 207.2 1.1e-55
QRN65366 Lig v 2.0101 134 717 207.2 1.2e-55
ABU95412 Sin a 4.0101 131 715 206.7 1.7e-55
Q9XG85 Par j 3 132 709 205.0 5.5e-55
CAD10377 Lyc e 1 131 707 204.4 8.1e-55
O24282 Phl p 12.0103 131 707 204.4 8.1e-55
Q93YG7 Sola l 1.0101 131 707 204.4 8.1e-55
A0A023W2L7 Pro j 2.0101 133 699 202.2 3.9e-54
Q9T0M8 Par j 3 131 697 201.6 5.7e-54
A0A0A0REA1 Koc s 2.0101 133 694 200.8 1e-53
Q42449 Ara t 8 131 685 198.2 5.9e-53
A0A0A0RCW1 Aca f 2 133 679 196.6 1.9e-52
O81982 Hel a 2 133 677 196.0 2.8e-52
ADK22841 Sal k 4.0201 133 676 195.7 3.5e-52
ACS34771 Sal k 4.0101 133 676 195.7 3.5e-52
AJ421030 Art v 4.0101 133 670 194.0 1.1e-51
AJ421031 Art v 4.0201 133 664 192.3 3.6e-51
FG438715 Act d 9.0101 109 609 177.0 1.2e-46
QEQ43417 Sola m 1.0101 159 511 149.3 4e-38
A0A1B2YLJ4 Tyr p 36.0101 131 284 85.5 5e-19
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 260.6 bits 907,  Expect = 1e-71
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYLFDQGF
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 2. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 227.8 bits 790,  Expect = 8e-62
 Identities = 110/130 84%, Positives = 124/130 95%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+CDIDG+ LTAAAI+GHDGSVWAQS +FPQ KPEE+AAIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGSGG+T+KKT  ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 3. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 226.6 bits 786,  Expect = 2e-61
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDIDG+ LTAAAI+GHDGSVWAQS +FPQ K +E+AA+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGSGG+T+KKT  ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL+DQG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 4. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 226.1 bits 784,  Expect = 2e-61
 Identities = 112/131 85%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C+ DGQ LTAAAI+GHDGSVWAQS  FPQ KP EIAAIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKT  ALIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 5. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 226.1 bits 784,  Expect = 2e-61
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHLLCDI+GQ L+AAAIVGHDGSVWAQS+ FP+ KPEE+A ++KDFDEPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG+GG+TIKKT ++LIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 224.4 bits 778,  Expect = 8e-61
 Identities = 108/130 83%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDIDG+ LTAAAI+GHDGSVWAQS  FPQ K +E+AA+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGSGG+T+KKT  ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 7. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 223.8 bits 776,  Expect = 1e-60
 Identities = 110/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+CDIDG+ LTAAAI+GHDGSVWAQS  FP+ KPEEI AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGGVT+KKT+ AL+ GIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 8. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 223.8 bits 776,  Expect = 1e-60
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+C+IDGQ L++AAI+GHD +VWAQS  FPQ KPEEI+AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG+GG+T+KKTNLALIIG+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL++QGF
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 9. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 223.3 bits 774,  Expect = 2e-60
 Identities = 105/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVD+HL+C+I+GQ L+AAAIVGHDGSVWAQS++FP+ KPEE+A I+KDFDEPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG+GG+TIKKT ++LIIG+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 223.0 bits 773,  Expect = 2e-60
 Identities = 108/130 83%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDIDG+ LTAAAI+GHDGSVWAQS +FPQ K +E+AAIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT+ ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 11. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 222.1 bits 770,  Expect = 4e-60
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+IDGQ LTAAAI+GHDGSVWAQS +FPQ KPEEIAAIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG+GG+T+KKT  ALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 12. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 221.0 bits 766,  Expect = 8e-60
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSW+AYVDDHL C+IDGQ LT+AAI+GHDGSVWAQS  FPQ KPEEIA I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT +ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 13. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 221.0 bits 766,  Expect = 8e-60
 Identities = 111/131 84%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHLLCDI+G  LT AAI+G+DGSVWAQS  FPQ KPEEI AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKG GGVT+KKT  ALIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            R GDYL DQG+
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 14. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 220.2 bits 763,  Expect = 1e-59
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDI+G  LT+AAI+GHDGSVWA S +FPQ   EE++AIMKDF+EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGSGGVT+KKTN ALIIG+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 15. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 219.6 bits 761,  Expect = 2e-59
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+C+I+G  L+AAAI+GHDGSVWAQS  FPQ KPEE+  I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKG GGVT+KK+ LAL+IGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 16. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 219.6 bits 761,  Expect = 2e-59
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL C+IDGQ LT+AAI+GHDGSVWA+S  FP+ KPEEIA I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT +ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 17. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 219.3 bits 760,  Expect = 3e-59
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+CDIDG  LTAAAI+G+DGSVW+QS  FP  KPEEIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGG+T+KKTN ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 18. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 219.0 bits 759,  Expect = 3e-59
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDI+G  L++AAI+GHDG+VWAQS +FPQ KPEE++AIMKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GGVTIKKTN ALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            R+GDYL +QG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 19. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 219.0 bits 759,  Expect = 3e-59
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDD L+CDIDG+ LTAAAI+GHDGSVWA+S  FP+ KPEEI AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGGVT+KKT  AL+ GIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 20. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 219.0 bits 759,  Expect = 3e-59
 Identities = 110/131 83%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHLLC I+G  LT AAI+G+DGSVW QS  FPQ KPEEI AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKG GGVT+KKT  ALIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 21. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 219.0 bits 759,  Expect = 4e-59
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSW+AYVDDHL C+IDGQ LT+AAI+GHDGSVWAQS  FPQ KPEE A I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT +ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 22. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 218.8 bits 758,  Expect = 4e-59
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+CDIDG  LTAAAI+G+DGSVW+QS +FP  KPEEIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGSGG+TIKKT+ AL+IGIY+EP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 23. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 218.2 bits 756,  Expect = 6e-59
 Identities = 109/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVD+HL+C+IDG+ LTAAAI+GHDGSVWAQS +FPQ K EEI  IM DF+EPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKGSGGVT+KKTN ALI GIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 24. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 218.2 bits 756,  Expect = 6e-59
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAY D+HL+C+I+G  L AAAI+GHDGSVWAQS  FPQ KPEEI  +M DF+EPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKG GGVT+KKT+ ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 25. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 217.9 bits 755,  Expect = 7e-59
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLLCDIDG---QCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
            MSWQAYVDDHL+C+++G   Q LTAAAI+GHDGSVWAQS  FPQ KPEEIA IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP AVIRGKKGSGGVTIKKT  AL+ G+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLFDQGF 131
            +VERLGDYL DQG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 26. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 217.6 bits 754,  Expect = 9e-59
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+C+I+G  L+AAAI+GH+GSVWAQS  FPQ KPEE+  IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GGVT+KK+ +AL+IGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 27. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 217.6 bits 754,  Expect = 9e-59
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDIDG  LTAAAI+G+DGSVW+QS  FP  KPEEIAAI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGG+T+KKTN ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 28. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 217.6 bits 754,  Expect = 9e-59
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDIDG  LTAAAI+G+DGSVW+QS  FP  KPEEIAAI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGG+T+KKTN ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 29. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 217.4 bits 753,  Expect = 1e-58
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+CDIDG  LTAAAI+G+DGSVW+QS  FP  KPEEIAAI+KD+D+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGG+T+KKTN ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 30. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 217.4 bits 753,  Expect = 1e-58
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL C+IDGQ LT+AAI+GHDG VW QS  FPQ KPEEIA I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT + LI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QGF
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 31. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 217.1 bits 752,  Expect = 1e-58
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+C+I+G  L+AAAI+G+DGSVWAQS  FPQ K EEI  IM DF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKG GGVT+KKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 32. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 216.8 bits 751,  Expect = 2e-58
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+C+I+G+ LT+AAI+GHDG+VWAQS AFP  KPEE+A IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGGVT+KKT  AL+IGIY+EPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLFDQG 130
            +LGDYL +QG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 33. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 216.8 bits 751,  Expect = 2e-58
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL C+IDGQ LT+AAI+GHDGSVW +S  FP+ KPEEIA I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT +ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 34. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 216.5 bits 750,  Expect = 2e-58
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ LT+AAIVGHDG+ WAQS AFP+ KPEE+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGG+T+KKT  +LIIGIY+EPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 35. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 215.7 bits 747,  Expect = 3e-58
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ LT+AAIVGHDG+VWAQS AFPQ KPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 36. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 215.4 bits 746,  Expect = 4e-58
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+C+I+G  LT+AAI+G+DGSVWA+S+ FPQ KPEEI  I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLY+GG+KYMVIQGEPGAVIRGKKG GGVT+KKT LAL+IGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 214.3 bits 742,  Expect = 9e-58
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDI+G  LT+AAI+G+DGSVWAQS  FPQ KPEEI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG+GG+T+KKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDY+ +QG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 38. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 213.7 bits 740,  Expect = 1e-57
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ Y D+HL+C+I+G  L AAAI+GHDGSVWAQS  FPQ KPEEI  +M DF+EPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIR KKG GGVT+KKT+ ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 39. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 213.1 bits 738,  Expect = 2e-57
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G  LT+AAI+G+DGSVWAQS  FPQ KPEE+A I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKG GGVT+KKT +AL+IGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL DQG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 40. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 212.9 bits 737,  Expect = 2e-57
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+CD+DG+ LT+AAI+GHDGSVWAQS  FP+ KP EI AI+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKGSGGVTIKK+N+ALI G+Y+EPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 41. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 212.9 bits 737,  Expect = 2e-57
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVDDHL+CDIDG  LTAAAI+G+DGSVW+QS  FP  + EEIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGG+ +KKTN ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 42. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 212.9 bits 737,  Expect = 2e-57
 Identities = 106/130 81%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVDDHL+CDIDGQ   L AA+IVGHDGS+WAQS +FPQ KPEEI  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
             LAPTGLY+ GTKYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL +QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 43. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 212.3 bits 735,  Expect = 3e-57
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C+I+G  LT+AAI+G+DGSVWAQS  FPQ KPEEI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKG GG+T+KKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +Q +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 44. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 212.0 bits 734,  Expect = 4e-57
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAIVGHDG+VWAQS AFPQ KPEE+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT  AL+IGIY+EPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 45. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 212.0 bits 734,  Expect = 4e-57
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQAYVD+HL+C+I+G+ L AAAIVGHDG+ WAQS AFP+ K E++A IMKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 46. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 211.4 bits 732,  Expect = 6e-57
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLLCDIDG---QCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
            MSWQ YVDDHL+C++DG   Q L+AAAI+GHDGSVWAQS  FP+ KPEEI  IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP AVIRGKKGSGGVTIKKT  AL+ G+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLFDQGF 131
            +VERLGDYL +QG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 47. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 210.9 bits 730,  Expect = 9e-57
 Identities = 107/131 81%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVD+HL+CDIDGQ   L AAAI+GHDGSVWAQS  FPQ K EEI+ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
             LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGGVTIKKT+ AL+ GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLFDQGF 131
            VERLGDYL DQG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 48. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 210.0 bits 727,  Expect = 2e-56
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLLCDIDGQC---LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
            MSWQAYVDDHL+CDI+G+    LTAAAIVGHDGSVWAQS  FPQ KPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLFDQGF 131
            VVERLGDYL++QG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 49. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 209.8 bits 726,  Expect = 2e-56
 Identities = 106/131 80%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVD+HL+CDIDGQ   LTAAAI+GHDGS+WAQS +FPQ K +EI  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
             LAPTGL+L GTKYMVIQGEPGAVIRGKKGSGGVTIKKT  ALI GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLFDQGF 131
            VERLGDYL DQG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 50. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 209.2 bits 724,  Expect = 3e-56
 Identities = 99/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ L +AAI+GHDG+VWAQS  FPQ KPEEI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG+GG+TIKKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 51. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 209.2 bits 724,  Expect = 3e-56
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+ L+C+I+G  LTAAAI+G+DGSVWAQS  FPQ K EEI AIM DFDEPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVT++KTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 52. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 209.2 bits 724,  Expect = 3e-56
 Identities = 104/131 79%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCDIDGQCLT--AAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVD+HL+CDIDGQ     A+AIVGHDGSVWAQS +FPQ KP+EI  IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLFDQGF 131
            VERLGDYL DQG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 53. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 209.2 bits 724,  Expect = 3e-56
 Identities = 106/130 81%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIDGQC---LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
            MSWQAYVDDHL+CDI+G+    LTAAAIVGHDGSVWAQS  FPQ KPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLFDQG 130
            VVERLGDYL +QG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 54. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 208.6 bits 722,  Expect = 4e-56
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLLC+I+G  L++AAI+G+DG VWAQS  FPQ KPEEI AIM DF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKG GGVTI+KTN ALIIGIY++PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL D G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 55. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 208.6 bits 722,  Expect = 4e-56
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLLCDIDGQC---LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
            MSWQAYVDDHL+CDI+G+    LTAAAIVGHDGSVWAQS  FPQ KPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLFDQGF 131
            V ERLGDYL++QG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 56. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 207.8 bits 719,  Expect = 8e-56
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQAYVDDHL+C+I+G    LT AAI+G DGSVWAQS  FPQ KP+EIAAI++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG+GG+ +KKT  AL++GIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLFDQGF 131
            VERLGDYL +QG+
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 57. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 207.2 bits 717,  Expect = 1e-55
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ L +AAI+GHDG+VWAQS  FPQ KPEEI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG+GG+TIKKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 58. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 207.2 bits 717,  Expect = 1e-55
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ L +AAI+GHDG+VWAQS  FPQ KPEEI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG+GG+TIKKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 59. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 207.2 bits 717,  Expect = 1e-55
 Identities = 106/130 81%, Positives = 115/130 88%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIDGQC---LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
            MSWQAYVDDHL+CDI+G+    LTAAAIVGHDGSVWAQS  FPQ KPEEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
            G+LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG+TIKKTN AL+ GIY EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLFDQG 130
            VV RLGD L  QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 60. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 206.7 bits 715,  Expect = 2e-55
 Identities = 101/131 77%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CD++G  LTAAAI+G+DGSVWAQS  FPQ KPEEI  I  DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP AVIRGKKG+GGVTIKKT  A++ GIY EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +QG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 61. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 205.0 bits 709,  Expect = 6e-55
 Identities = 100/131 76%, Positives = 115/131 87%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLLCDI-DGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGS 59
            MSWQAYVDDHL+CD+ DG    +AAI+GHDGSVWAQS  FPQ KPEE+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG T+KKT  A++IGIY+EPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLFDQGF 131
            ERLGDYL++QG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 62. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 204.4 bits 707,  Expect = 8e-55
 Identities = 101/131 77%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLLC+ +G  LT+AAI+G+DG+VWAQS  FPQ KPEEI  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKG GG+TIKKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +Q +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 63. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 204.4 bits 707,  Expect = 8e-55
 Identities = 97/130 74%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HL+C+I+G+ L +AAI GHDG+VWAQS  FPQ KPEEI  IMKD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPGAVIRGKKG+GG+TIKKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLFDQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 64. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 204.4 bits 707,  Expect = 8e-55
 Identities = 101/131 77%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLLC+ +G  LT+AAI+G+DG+VWAQS  FPQ KPEEI  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKG GG+TIKKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLFDQGF 131
            RLGDYL +Q +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 65. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 202.2 bits 699,  Expect = 4e-54
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVDDHL+C+I+G    L+AAAI+G DGSVWAQS +FPQ KP+EI+A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKG GG+ +KKT  ALIIGIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL +QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 66. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 201.6 bits 697,  Expect = 6e-54
 Identities = 100/129 77%, Positives = 114/129 88%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLLCDI-DGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGS 59
            MSWQAYVDDHL+CD+ DG  L +AAI+GHDGSVWAQS  FPQ KPEE+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKGSGG T+KKT  A++IGIY+EPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLFDQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 67. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 200.8 bits 694,  Expect = 1e-53
 Identities = 100/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVDDHL+CDI+G    LT AAI+G DGSVWAQS  FPQ KP+EIAAI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+ +KKT  ALI GIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL +QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 68. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 198.2 bits 685,  Expect = 6e-53
 Identities = 98/128 76%, Positives = 111/128 86%, Gaps = 0/128 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ+YVDDHL+CD++G  LTAAAI+G+DGSVWAQS  FPQ KP+EI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
            APTGL+LGG KYMVIQGE GAVIRGKKG GGVTIKKTN AL+ G Y+EPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLFD 128
            RLGDYL +
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 69. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 196.6 bits 679,  Expect = 2e-52
 Identities = 95/130 73%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            M WQ YVDDHL+C+I+G    L+ AAI+G DGSVWAQS +FPQ KP+EIAA++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG  IRGKKG GG+ +KKT  AL+ GIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL +QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 70. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 196.0 bits 677,  Expect = 3e-52
 Identities = 94/130 72%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDG--QCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQAYVD+HL+CDI+G  Q LT+AAI+G DG+VWAQS  FPQ KPEE+  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG+GG+ IKKT  A+I+GIY+EP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 71. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 195.7 bits 676,  Expect = 3e-52
 Identities = 98/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCDID--GQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQAYVD+HL+C+I+  G  LT++AIVG DGS+WAQS  FPQ KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKG GGV IKKT  ALI GIY+EP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLFDQGF 131
            VERLGDYL +QG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 72. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 195.7 bits 676,  Expect = 3e-52
 Identities = 97/130 74%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVDDHL+C+I+G    LTAAAI+G DGSVWAQS  FPQ KP+EI+A++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+ +KKT  ALI GIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL +QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 73. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 194.0 bits 670,  Expect = 1e-51
 Identities = 95/130 73%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIDG--QCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVDDHL+CDI+G  Q LT+AAI G DG+VWA+S +FP+ KP EI AI+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE GAVIRGKKG+GG+ IKKT  A++ GIY+EP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLFDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 192.3 bits 664,  Expect = 4e-51
 Identities = 92/129 71%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLLCDIDG--QCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
            MSWQ YVDDHL+CDI+G  Q LTAAAI+G DG+VWA+SD FP+ KPEE+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG+GG+ IKKT  A+++GIY+EP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLFDQ 129
            VERLGDYL DQ
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 177.0 bits 609,  Expect = 1e-46
 Identities = 87/109 79%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C+I+G  LT+AAI+G+DGS+WAQS +FPQ KPEEI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEP 109
            APTGLYLGGTKYMVIQGE GAVIRGKKG GGVT+KKTN ALIIGIY+EP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 149.3 bits 511,  Expect = 4e-38
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 28/131 21%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQ-----C------------- 42
            MSWQ YVDDHL+CD++G+ L +AAI+G DGSVWAQS AFP+     C             
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  43   ----------KPEEIAAIMKDFDEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGV 92
                      KPEEI  IMKDFDEPG LAPTGL+LGGTKYMVIQGEPGAVIRGKKGS G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTNLALIIGIYNEPMTPGQCNMVVERLGDYLFDQGF 131
            TIKKT  ALI GIY EP+TPGQCNMVVE++GDYL DQG+
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 85.5 bits 284,  Expect = 5e-19
 Identities = 52/122 42%, Positives = 75/122 61%, Gaps = 8/122 6%
Query  1    MSWQAYVDDHLLCDIDGQCLTAAAIVG-HDGSVWAQ--SDAFPQCKPEEIAAIMKDF-DE 56
            MSWQ+YVD+++   +D  C   A I G +DG+VWA+   D   Q   +E+  I       
Sbjct  1    MSWQSYVDNQICQHVD--C-RLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCN 116
            P S+   G++LGG KY+ IQ +  +++RG+KGS  + I  TN  L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.