The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL
APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
RPGDYLIDQGY
Sequence Info Allergen Name Length Opt Bits Score E Value
O65809 Gly m 3 131 908 242.2 3.6e-66
O65810 Gly m 3 131 878 234.4 7.8e-64
Q9STB6 Hev b 8.0102 131 811 217.0 1.3e-58
Q5XWE1 Citr l 2.0101 131 802 214.7 6.6e-58
CAD37202 Pru p 4.0201 131 795 212.9 2.3e-57
AAL29690 Lyc e 1 131 793 212.4 3.3e-57
Q9XF41 Mal d 4 131 791 211.8 4.8e-57
Q9AXH4 Cor a 2 131 790 211.6 5.7e-57
AAP13533 Cuc m 2 131 787 210.8 9.8e-57
CAD10376 Cap a 2 131 786 210.5 1.2e-56
AAL07320 Lit c 1 131 779 208.7 4.1e-56
Q9M7N0 Hev b 8.0201 131 778 208.5 4.9e-56
AAL92870 Che a 2 131 778 208.5 4.9e-56
Q9SQI9 Ara h 5 131 777 208.2 5.9e-56
AAK01235 Cor a 2 131 774 207.4 1e-55
Q93YG7 Sola l 1.0101 131 769 206.1 2.5e-55
CAD10377 Lyc e 1 131 769 206.1 2.5e-55
O65812 Hev b 8.0101 131 767 205.6 3.5e-55
AF377948 Mus a 1.0101 131 766 205.4 4.2e-55
ACP43298 Ama r 2.0101 133 766 205.4 4.3e-55
Q9XF38 Pyr c 4 131 764 204.8 6.1e-55
Q9LEI8 Hev b 8.0204 131 764 204.8 6.1e-55
Q8L5D8 Pho d 2.0101 131 763 204.6 7.3e-55
AAK54835 Ana c 1 131 763 204.6 7.3e-55
FM164277 Tri a 12.0104 131 762 204.3 8.7e-55
Q9FR39 Zea m 12.0105 131 761 204.1 1e-54
A0A2I4DNN6 Jug r 7.0101 131 758 203.3 1.8e-54
QID21357 Pop n 2.0101 131 757 203.0 2.1e-54
Q9M7M8 Hev b 8.0203 131 757 203.0 2.1e-54
P49233 Tri a 12.0102 141 757 203.0 2.3e-54
Q9XF40 Mal d 4 131 756 202.8 2.6e-54
Q9FUD1 Ory s 12.0101 131 755 202.5 3.1e-54
O24650 Phl p 12.0102 131 754 202.2 3.7e-54
O04725 Cyn d 12 131 752 201.7 5.2e-54
Q9XF42 Mal d 4 131 751 201.5 6.3e-54
CAD37201 Pru p 4.0101 131 749 201.0 9e-54
P35081 Zea m 12.0101 131 749 201.0 9e-54
CAA54686 Phl p 12.0101 131 747 200.4 1.3e-53
O22655 Zea m 12.0104 131 747 200.4 1.3e-53
P35079 Phl p 12.0101 131 747 200.4 1.3e-53
P49232 Tri a 12.0101 138 747 200.4 1.4e-53
P35083 Zea m 12.0103 131 746 200.2 1.5e-53
P49234 Tri a 12.0103 140 745 199.9 2e-53
AY081850 Pru du 4.0101 131 743 199.4 2.6e-53
Q9M7M9 Hev b 8.0202 131 743 199.4 2.6e-53
AY081852 Pru du 4.0102 131 743 199.4 2.6e-53
Q9XF39 Pru av 4 131 742 199.1 3.2e-53
A0A023W2L7 Pro j 2.0101 133 741 198.9 3.9e-53
ABU95412 Sin a 4.0101 131 739 198.4 5.4e-53
A0A0A0REA1 Koc s 2.0101 133 738 198.1 6.6e-53
O24282 Phl p 12.0103 131 737 197.8 7.8e-53
P52184 Hor v 12.0101 131 737 197.8 7.8e-53
O24169 Ole e 2 134 733 196.8 1.6e-52
Q9XF37 Api g 4 134 732 196.5 2e-52
O24170 Ole e 2 134 730 196.0 2.8e-52
P35082 Zea m 12.0102 131 728 195.5 3.9e-52
Q5EF31 Cro s 1.0101 131 727 195.2 4.7e-52
P84177 Cit s 2.0101 131 726 195.0 5.6e-52
O24171 Ole e 2 134 725 194.7 6.9e-52
Q9XG85 Par j 3 132 723 194.2 9.7e-52
ACS34771 Sal k 4.0101 133 722 194.0 1.2e-51
AAL76933 Dau c 4 134 722 193.9 1.2e-51
A0A0A0RCW1 Aca f 2 133 720 193.4 1.7e-51
O49894 Mer a 1 133 717 192.7 2.9e-51
Q42449 Ara t 8 131 713 191.6 5.8e-51
QVU02258 Que ac 2.0101 133 713 191.6 5.9e-51
Q9T0M8 Par j 3 131 712 191.4 6.9e-51
XP030492464 Can s 2.0101 133 711 191.1 8.4e-51
QRN65366 Lig v 2.0101 134 711 191.1 8.5e-51
P25816 Bet v 2 133 704 189.3 3e-50
ADK22841 Sal k 4.0201 133 701 188.5 5.1e-50
AJ421030 Art v 4.0101 133 695 187.0 1.5e-49
O81982 Hel a 2 133 691 185.9 3.1e-49
AJ421031 Art v 4.0201 133 690 185.7 3.7e-49
FG438715 Act d 9.0101 109 666 179.5 2.2e-47
QEQ43417 Sola m 1.0101 159 522 142.1 5.8e-36
A0A1B2YLJ4 Tyr p 36.0101 131 273 77.6 1.2e-16
C0HJX6 Pla l 2.0101 42 88 30.0 0.0086
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 242.2 bits 908,  Expect = 4e-66
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQGY 131
            RPGDYLIDQGY
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 2. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 234.4 bits 878,  Expect = 8e-64
 Identities = 128/131 97%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLC IEGNHLTHAAIIGQDGSVW QSTDFPQFKPEEITAIMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 217.0 bits 811,  Expect = 1e-58
 Identities = 115/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEGNHL+ AAIIGQDGSVWAQS +FPQFK EEIT IM+DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 4. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 214.7 bits 802,  Expect = 7e-58
 Identities = 112/130 86%, Positives = 124/130 95%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEGNHLT AAIIGQDGSVWA+S +FPQ+KPEEIT I+NDFNEPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLY+GG+KYMVIQGEPGAVIRGKKGPGGVTVKKT  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 5. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 212.9 bits 795,  Expect = 2e-57
 Identities = 111/130 85%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEGNHL+ AAIIG+DGSVWAQS  FPQ+KPEE+T I+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 6. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 212.4 bits 793,  Expect = 3e-57
 Identities = 113/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDIEGNHLT AAIIGQDGSVWAQS +FPQFKPEEITAIMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDY+I+QG
Sbjct  121  RLGDYIIEQG 130

Sequence Alignment: 7. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 211.8 bits 791,  Expect = 5e-57
 Identities = 112/130 86%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEGNHL+ AAIIG++GSVWAQS  FPQ+KPEE+T IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 8. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 211.6 bits 790,  Expect = 6e-57
 Identities = 113/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAY D+HL+C+IEGN L  AAIIG+DGSVWAQS+ FPQ+KPEEIT +MNDFNEPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 9. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 210.8 bits 787,  Expect = 1e-56
 Identities = 109/130 83%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEGNHLT AAIIGQDGSVWAQS +FPQ+KPEE+  I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTG AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 10. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 210.5 bits 786,  Expect = 1e-56
 Identities = 113/129 87%, Positives = 119/129 92%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C+IEGN LT AAIIGQDGSVWAQS  FPQFKPEEITAIMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQ 129
            R GDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 11. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 208.7 bits 779,  Expect = 4e-56
 Identities = 110/130 84%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C+ +G HLT AAIIG+DGSVWAQS +FPQFKP EI AIM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL+DQG
Sbjct  121  RLGDYLVDQG 130

Sequence Alignment: 12. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 208.5 bits 778,  Expect = 5e-56
 Identities = 108/130 83%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+CDI+G+HLT AAIIG+DGSVWAQS+ FPQFKPEE+ AIM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 13. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 208.5 bits 778,  Expect = 5e-56
 Identities = 108/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDIEGNHL+ AAI+G+DG+VWAQS  FPQ+KPEE++AIM DFNEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KKT  ALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 14. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 208.2 bits 777,  Expect = 6e-56
 Identities = 109/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HLLC+IEG+HL+ AAI+GQDG VWAQS+ FPQFKPEEITAIMNDF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKGPGGVT++KT  ALIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLID G
Sbjct  121  RLGDYLIDTG 130

Sequence Alignment: 15. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 207.4 bits 774,  Expect = 1e-55
 Identities = 111/130 85%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ Y D+HL+C+IEGN L  AAIIG+DGSVWAQS+ FPQ+KPEEIT +MNDFNEPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIR KKGPGGVTVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 16. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 206.1 bits 769,  Expect = 2e-55
 Identities = 109/129 84%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HLLC+ EGNHLT AAIIGQDG+VWAQS +FPQFKPEEIT IMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQ 129
            R GDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 17. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 206.1 bits 769,  Expect = 2e-55
 Identities = 109/129 84%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HLLC+ EGNHLT AAIIGQDG+VWAQS +FPQFKPEEIT IMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQ 129
            R GDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 18. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 205.6 bits 767,  Expect = 4e-55
 Identities = 109/130 83%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+ L+C+IEGNHLT AAIIGQDGSVWAQS++FPQFK EEITAIM+DF+EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGPGGVTV+KT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 19. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 205.4 bits 766,  Expect = 4e-55
 Identities = 111/131 84%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLCDI+G  LT AAI+G+DGSVWAQS  FPQ KPEEI AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKG GGVT+KKT  ALIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYL DQG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 20. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 205.4 bits 766,  Expect = 4e-55
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQAYVDDHL+C+IEG  NHLT AAI+G DGSVWAQS DFPQFKP+EI AI+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG GG+ VKKTG AL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERPGDYLIDQGY 131
            VER GDYLI+QGY
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 21. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 204.8 bits 764,  Expect = 6e-55
 Identities = 108/130 83%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+CDI+G+HLT AAI+G+DGSVWAQS+ FP+FKPEEITAIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKT  AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 204.8 bits 764,  Expect = 6e-55
 Identities = 106/130 81%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDI+G+ LT AAIIG+DGSVWAQS+ FPQFK +E+ A+M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL+DQG
Sbjct  121  RLGDYLLDQG 130

Sequence Alignment: 23. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 204.6 bits 763,  Expect = 7e-55
 Identities = 110/130 84%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVD+HL+C+I+G+HLT AAI+G+DGSVWAQS+ FPQFK EEIT IMNDFNEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKG GGVTVKKT  ALI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 24. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 204.6 bits 763,  Expect = 7e-55
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C+I+G HL+ AAI+G+D +VWAQS +FPQFKPEEI+AI+NDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GG+TVKKT  ALIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYL++QG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 25. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 204.3 bits 762,  Expect = 9e-55
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSW+AYVDDHL C+I+G HLT AAI+G+DGSVWAQS +FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 26. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 204.1 bits 761,  Expect = 1e-54
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLCDIEG HL+ AAI+G+DGSVWAQS +FP++KPEE+  ++ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTG +LIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 27. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 203.3 bits 758,  Expect = 2e-54
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+I+G HLT AAIIG+DGSVWAQS+ FPQFKPEEI AIM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKTG ALI GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 28. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 203.0 bits 757,  Expect = 2e-54
 Identities = 108/130 83%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDIEGN LT AAIIG+DGSVWA S  FPQF  EE++AIM DF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GGVTVKKT  ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 203.0 bits 757,  Expect = 2e-54
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDI+G+ LT AAIIG+DGSVWAQS+ FPQFK +E+ A+M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 30. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 203.0 bits 757,  Expect = 2e-54
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL C+I+G HLT AAI+G+DGSVWA+S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 31. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 202.8 bits 756,  Expect = 3e-54
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDD L+CDI+G+HLT AAI+G+DGSVWA+S+ FP+FKPEEITAIM DF+EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKTG AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 32. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 202.5 bits 755,  Expect = 3e-54
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HLT AAI+G+DG+VWAQS  FPQFKPEE+T IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 33. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 202.2 bits 754,  Expect = 4e-54
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HL  AAI+G+DG+VWAQS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 34. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 201.7 bits 752,  Expect = 5e-54
 Identities = 106/130 81%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEG+HLT AAIIG+DG+VWAQS  FP FKPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GGVTVKKTG AL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RPGDYLIDQG 130
            + GDYLI+QG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 35. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 201.5 bits 751,  Expect = 6e-54
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKT  AL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 36. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 201.0 bits 749,  Expect = 9e-54
 Identities = 105/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 37. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 201.0 bits 749,  Expect = 9e-54
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HLT AAI+G+DG+ WAQST FP+FKPEE+ AIM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG +LIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 38. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 200.4 bits 747,  Expect = 1e-53
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HL  AAI+G+DG+VWAQS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 39. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 200.4 bits 747,  Expect = 1e-53
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVD+HL+C+IEG HL+ AAI+G+DGSVWAQS  FP++KPEE+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTG +LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 40. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 200.4 bits 747,  Expect = 1e-53
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HL  AAI+G+DG+VWAQS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 41. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 200.4 bits 747,  Expect = 1e-53
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL C+I+G HLT AAI+G+DGSVW +S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 42. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 200.2 bits 746,  Expect = 2e-53
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HL+ AAI+G+DG+VWAQST FPQFKPEE+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 43. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 199.9 bits 745,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSW+AYVDDHL C+I+G +LT AAI+G+DGSVWAQS +FPQFKPEE   I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 44. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 199.4 bits 743,  Expect = 3e-53
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 45. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 199.4 bits 743,  Expect = 3e-53
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDI+G+ LT AAIIG+DGSVWAQS+ FPQFK +E+ AIM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 46. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 199.4 bits 743,  Expect = 3e-53
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 47. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 199.1 bits 742,  Expect = 3e-53
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP FKPEEI AI+ D+++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 48. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 198.9 bits 741,  Expect = 4e-53
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C+IEG  NHL+ AAI+G DGSVWAQS  FPQFKP+EI+A++ DF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKGPGG+ VKKTG ALIIGIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERPGDYLIDQG 130
            VER GDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 49. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 198.4 bits 739,  Expect = 5e-53
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+CD+EGN LT AAI+GQDGSVWAQS +FPQ+KPEEI  I NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP AVIRGKKG GGVT+KKT  A++ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 50. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 198.1 bits 738,  Expect = 7e-53
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+CDIEG  NHLT AAI+G DGSVWAQS +FPQFKP+EI AI+ +F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKTG ALI GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERPGDYLIDQG 130
            VER GDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 51. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 197.8 bits 737,  Expect = 8e-53
 Identities = 99/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C+IEG+HL  AAI G+DG+VWAQS DFPQFKPEEIT IM D++EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPGAVIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 52. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 197.8 bits 737,  Expect = 8e-53
 Identities = 100/131 76%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL C+I+G HLT AAI+G+DG VW QS +FPQFKPEEI  I+ DF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG  LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYL++QG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 53. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 196.8 bits 733,  Expect = 2e-52
 Identities = 105/130 80%, Positives = 118/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIEG--NH-LTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+CDIEG  +H LT AAI+G+DGSVWAQS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERPGDYLIDQG 130
            VVER GDYL++QG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 54. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 196.5 bits 732,  Expect = 2e-52
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIEGNH---LTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+C++EGN    LT AAIIG+DGSVWAQS+ FPQ KPEEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GGVT+KKTG AL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERPGDYLIDQG 130
            +VER GDYLIDQG
Sbjct  121  IVERLGDYLIDQG 133

Sequence Alignment: 55. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 196.0 bits 730,  Expect = 3e-52
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIEGNH---LTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+CDIEG+    LT AAI+G+DGSVWAQS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERPGDYLIDQG 130
            VVER GDYL++QG
Sbjct  121  VVERLGDYLLEQG 133

Sequence Alignment: 56. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 195.5 bits 728,  Expect = 4e-52
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVD+HL+C+IEG+HL  AAI+G+DG+ WAQST FP+FK E++  IM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RPGDYLIDQG 130
            R GDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 57. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 195.2 bits 727,  Expect = 5e-52
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+CD++G+ LT AAI+G+DGSVWAQS  FP++KP EITAI+NDFNEPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKG GGVT+KK+  ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RPGDYLIDQGY 131
            R GDYLI+QGY
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 58. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 195.0 bits 726,  Expect = 6e-52
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP F+ EEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RPGDYLIDQG 130
            R GDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 59. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 194.7 bits 725,  Expect = 7e-52
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIEGNH---LTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+CDIEG+    LT AAI+G+DGSVWAQS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERPGDYLIDQG 130
            V ER GDYL++QG
Sbjct  121  VAERLGDYLLEQG 133

Sequence Alignment: 60. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 194.2 bits 723,  Expect = 1e-51
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLLCDI-EGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGS 59
            MSWQAYVDDHL+CD+ +GN    AAIIG+DGSVWAQS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERPGDYLIDQG 130
            ER GDYL++QG
Sbjct  121  ERLGDYLLEQG 131

Sequence Alignment: 61. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 194.0 bits 722,  Expect = 1e-51
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C+IEG  NHLT AAI+G DGSVWAQS +FPQFKP+EI+A++ +F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKTG ALI GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERPGDYLIDQG 130
            VER GDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 62. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 193.9 bits 722,  Expect = 1e-51
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIEGN---HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQ YVDDHL+C+++GN   +L+ AAIIG+DGSVWAQS+ FP+FKPEEIT IM +F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP AVIRGKKG GGVT+KKTG AL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERPGDYLIDQG 130
            +VER GDYLI+QG
Sbjct  121  IVERLGDYLIEQG 133

Sequence Alignment: 63. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 193.4 bits 720,  Expect = 2e-51
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            M WQ YVDDHL+C+IEG  NHL+ AAI+G DGSVWAQS  FPQFKP+EI A++ DF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG  IRGKKGPGG+ VKKTG AL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERPGDYLIDQG 130
            VER GDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 64. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 192.7 bits 717,  Expect = 3e-51
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+CDI+G   HL  A+I+G+DGS+WAQS  FPQ+KPEEIT IM DF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGLY+ GTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERPGDYLIDQG 130
            VER GDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 65. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 191.6 bits 713,  Expect = 6e-51
 Identities = 100/128 78%, Positives = 111/128 86%, Gaps = 0/128 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ+YVDDHL+CD+EGNHLT AAI+GQDGSVWAQS  FPQ+KP+EI  I  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGG KYMVIQGE GAVIRGKKGPGGVT+KKT  AL+ G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RPGDYLID 128
            R GDYLI+
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 66. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 191.6 bits 713,  Expect = 6e-51
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVD+HL+CDI+G   HL  AAIIG+DGSVWAQS++FPQFK EEI+ IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGL+LGGTKYMVIQGE GAVIRGKKG GGVT+KKT  AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERPGDYLIDQG 130
            VER GDYL+DQG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 67. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 191.4 bits 712,  Expect = 7e-51
 Identities = 103/129 79%, Positives = 117/129 90%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLLCDI-EGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGS 59
            MSWQAYVDDHL+CD+ +GN L  AAIIG+DGSVWAQS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERPGDYLIDQG 130
            ER GDYL++QG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 68. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 191.1 bits 711,  Expect = 8e-51
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVD+HL+CDI+G   HLT AAIIG+DGS+WAQS+ FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGL+L GTKYMVIQGEPGAVIRGKKG GGVT+KKTG ALI GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERPGDYLIDQG 130
            VER GDYL+DQG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 69. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 191.1 bits 711,  Expect = 9e-51
 Identities = 103/130 79%, Positives = 115/130 88%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCDIEG--NH-LTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+CDIEG  +H LT AAI+G+DGSVWAQS  FPQFKPEEI  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G+LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKT  AL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERPGDYLIDQG 130
            VV R GD L+ QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 70. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 189.3 bits 704,  Expect = 3e-50
 Identities = 101/129 78%, Positives = 115/129 89%, Gaps = 4/129 3%
Query  1    MSWQAYVDDHLLCDIEG---NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQ YVD+HL+CDI+G   N L  +AI+G+DGSVWAQS+ FPQFKP+EIT IM DF EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLA-SAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  VVERPGDYLIDQG 130
            VVER GDYLIDQG
Sbjct  120  VVERLGDYLIDQG 132

Sequence Alignment: 71. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 188.5 bits 701,  Expect = 5e-50
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIE--GNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQAYVD+HL+C+IE  GNHLT +AI+G DGS+WAQS++FPQ KP+EI AI  +F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKGPGGV +KKT  ALI GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERPGDYLIDQG 130
            VER GDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 187.0 bits 695,  Expect = 1e-49
 Identities = 97/130 74%, Positives = 110/130 84%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+CDIEG   HLT AAI G DG+VWA+S  FP+FKP EI AI+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE GAVIRGKKG GG+ +KKTG A++ GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERPGDYLIDQG 130
            VER GDYL+DQG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 73. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 185.9 bits 691,  Expect = 3e-49
 Identities = 94/130 72%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQAYVD+HL+CDIEG   HLT AAI+G DG+VWAQS  FPQFKPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG GG+ +KKTG A+I+GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERPGDYLIDQG 130
            VER GDYL++QG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 185.7 bits 690,  Expect = 4e-49
 Identities = 94/129 72%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+CDIEG   HLT AAI+G DG+VWA+S  FP+FKPEE+  I+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG GG+ +KKTG A+++GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERPGDYLIDQ 129
            VER GDYL+DQ
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 179.5 bits 666,  Expect = 2e-47
 Identities = 96/109 88%, Positives = 102/109 93%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C+IEGN+LT AAIIGQDGS+WAQS  FPQFKPEEITAIMNDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEP 109
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGGVTVKKT  ALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 142.1 bits 522,  Expect = 6e-36
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 28/131 21%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQ------------------- 41
            MSWQ YVDDHL+CD+EG+HL  AAI+G DGSVWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGV 92
                     FKPEEIT IM DF+EPG LAPTGL+LGGTKYMVIQGEPGAVIRGKKG  G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLIDQGY 131
            T+KKTG ALI GIY+EP+TPGQCNMVVE+ GDYL+DQGY
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 77.6 bits 273,  Expect = 1e-16
 Identities = 51/127 40%, Positives = 76/127 59%, Gaps = 8/127 6%
Query  1    MSWQAYVDDHLLCDIEGNHLTHAAIIG-QDGSVWAQ-STDFP-QFKPEEITAIMNDF-NE 56
            MSWQ+YVD+++ C      L  A I G QDG+VWA+   D+P Q   +E+  I +   + 
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCN 116
            P S+   G++LGG KY+ IQ +  +++RG+KG   + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERPGDYLIDQGY 131
             VVE+ GDYL    Y
Sbjct  117  NVVEKLGDYLKANNY 131

Sequence Alignment: 78. Allergen Name: Pla l 2.0101 Sequence ID: C0HJX6

 Score = 30.0 bits 88,  Expect = 0.009
 Identities = 28/32 87%, Positives = 30/32 93%, Gaps = 29/32 90%
Query  24   AIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVI 83
            AI+GQDGSVWAQ                            GL+LGG KY VI GEPGAVI
Sbjct  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
Query  84   R 84
            R
Sbjct  32   R 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.