The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL
APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE
RLGDYLIEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9XF42 Mal d 4 131 878 246.9 1.4e-67
CAD37201 Pru p 4.0101 131 848 238.6 4.1e-65
AY081850 Pru du 4.0101 131 842 237.0 1.3e-64
AY081852 Pru du 4.0102 131 842 237.0 1.3e-64
Q9XF39 Pru av 4 131 841 236.7 1.5e-64
P84177 Cit s 2.0101 131 825 232.3 3.2e-63
Q9M7N0 Hev b 8.0201 131 789 222.5 3e-60
Q9M7M9 Hev b 8.0202 131 784 221.1 7.8e-60
Q9LEI8 Hev b 8.0204 131 784 221.1 7.8e-60
Q9M7M8 Hev b 8.0203 131 781 220.3 1.4e-59
Q9XF38 Pyr c 4 131 777 219.2 2.9e-59
AAL07320 Lit c 1 131 773 218.1 6.3e-59
O04725 Cyn d 12 131 771 217.5 9.2e-59
AAL29690 Lyc e 1 131 768 216.7 1.6e-58
CAD10376 Cap a 2 131 768 216.7 1.6e-58
A0A2I4DNN6 Jug r 7.0101 131 767 216.4 2e-58
QID21357 Pop n 2.0101 131 766 216.2 2.4e-58
CAD37202 Pru p 4.0201 131 760 214.5 7.4e-58
ABU95412 Sin a 4.0101 131 759 214.2 8.9e-58
AF377948 Mus a 1.0101 131 758 214.0 1.1e-57
Q9STB6 Hev b 8.0102 131 757 213.7 1.3e-57
ACP43298 Ama r 2.0101 133 757 213.7 1.3e-57
Q9XF40 Mal d 4 131 756 213.4 1.6e-57
Q9FR39 Zea m 12.0105 131 755 213.1 1.9e-57
Q9FUD1 Ory s 12.0101 131 754 212.9 2.3e-57
O22655 Zea m 12.0104 131 753 212.6 2.8e-57
Q9AXH4 Cor a 2 131 753 212.6 2.8e-57
A0A023W2L7 Pro j 2.0101 133 752 212.3 3.4e-57
O65809 Gly m 3 131 751 212.1 4.1e-57
Q9XF41 Mal d 4 131 751 212.1 4.1e-57
Q5XWE1 Citr l 2.0101 131 750 211.8 4.9e-57
P35081 Zea m 12.0101 131 750 211.8 4.9e-57
AAL76933 Dau c 4 134 749 211.5 6.2e-57
Q9XF37 Api g 4 134 749 211.5 6.2e-57
AAL92870 Che a 2 131 748 211.2 7.2e-57
Q8L5D8 Pho d 2.0101 131 748 211.2 7.2e-57
O65810 Gly m 3 131 747 211.0 8.7e-57
FM164277 Tri a 12.0104 131 745 210.4 1.3e-56
P49233 Tri a 12.0102 141 745 210.4 1.4e-56
AAK54835 Ana c 1 131 744 210.1 1.5e-56
O24650 Phl p 12.0102 131 742 209.6 2.3e-56
P52184 Hor v 12.0101 131 741 209.3 2.7e-56
P49232 Tri a 12.0101 138 741 209.3 2.9e-56
O24169 Ole e 2 134 740 209.0 3.4e-56
O24170 Ole e 2 134 740 209.0 3.4e-56
P35083 Zea m 12.0103 131 739 208.8 4e-56
A0A0A0REA1 Koc s 2.0101 133 739 208.8 4.1e-56
AAK01235 Cor a 2 131 737 208.2 5.8e-56
O65812 Hev b 8.0101 131 737 208.2 5.8e-56
AAP13533 Cuc m 2 131 736 207.9 7.1e-56
P49234 Tri a 12.0103 140 736 207.9 7.7e-56
CAA54686 Phl p 12.0101 131 735 207.7 8.5e-56
P35079 Phl p 12.0101 131 735 207.7 8.5e-56
O24171 Ole e 2 134 735 207.7 8.8e-56
P35082 Zea m 12.0102 131 733 207.1 1.2e-55
O49894 Mer a 1 133 733 207.1 1.3e-55
A0A0A0RCW1 Aca f 2 133 732 206.8 1.5e-55
CAD10377 Lyc e 1 131 730 206.3 2.2e-55
Q93YG7 Sola l 1.0101 131 730 206.3 2.2e-55
QRN65366 Lig v 2.0101 134 729 206.0 2.7e-55
O24282 Phl p 12.0103 131 723 204.4 8.3e-55
ACS34771 Sal k 4.0101 133 722 204.1 1e-54
QVU02258 Que ac 2.0101 133 721 203.8 1.2e-54
Q5EF31 Cro s 1.0101 131 719 203.3 1.8e-54
Q9XG85 Par j 3 132 719 203.3 1.8e-54
Q9SQI9 Ara h 5 131 717 202.7 2.6e-54
Q42449 Ara t 8 131 717 202.7 2.6e-54
XP030492464 Can s 2.0101 133 712 201.4 6.9e-54
O81982 Hel a 2 133 711 201.1 8.3e-54
P25816 Bet v 2 133 711 201.1 8.3e-54
ADK22841 Sal k 4.0201 133 709 200.5 1.2e-53
Q9T0M8 Par j 3 131 706 199.7 2.1e-53
AJ421030 Art v 4.0101 133 696 197.0 1.4e-52
AJ421031 Art v 4.0201 133 680 192.6 3e-51
FG438715 Act d 9.0101 109 631 179.2 2.6e-47
QEQ43417 Sola m 1.0101 159 521 148.9 4.9e-38
A0A1B2YLJ4 Tyr p 36.0101 131 267 79.4 3.4e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 246.9 bits 878,  Expect = 1e-67
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 2. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 238.6 bits 848,  Expect = 4e-65
 Identities = 123/131 93%, Positives = 130/131 99%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSA+FPAFKPEEIAAILKDFDQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 3. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 237.0 bits 842,  Expect = 1e-64
 Identities = 122/131 93%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDGNRLTAAAILGQDGSVWSQSA+FPAFKPEEIAAILKDFDQPGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 4. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 237.0 bits 842,  Expect = 1e-64
 Identities = 122/131 93%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDGNRLTAAAILGQDGSVWSQSA+FPAFKPEEIAAILKDFDQPGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 5. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 236.7 bits 841,  Expect = 2e-64
 Identities = 122/131 93%, Positives = 130/131 99%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSA+FPAFKPEEIAAILKD+DQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 6. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 232.3 bits 825,  Expect = 3e-63
 Identities = 120/131 91%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSA+FPAF+ EEIAAILKDFDQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGGI +KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 7. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 222.5 bits 789,  Expect = 3e-60
 Identities = 109/131 83%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMCDIDG+ LTAAAI+G+DGSVW+QS+SFP FKPEE+AAI+KDFD+PG+L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 8. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 221.1 bits 784,  Expect = 8e-60
 Identities = 109/131 83%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS+SFP FK +E+AAI+KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGIT+KKTSQAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 9. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 221.1 bits 784,  Expect = 8e-60
 Identities = 108/131 82%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS+SFP FK +E+AA++KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 220.3 bits 781,  Expect = 1e-59
 Identities = 107/131 81%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS+ FP FK +E+AA++KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 11. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 219.2 bits 777,  Expect = 3e-59
 Identities = 109/131 83%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDG+ LTAAAILG+DGSVW+QS++FP FKPEEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+T+KKTSQAL+ GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 12. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 218.1 bits 773,  Expect = 6e-59
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA+FP FKP EIAAI+KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GGIT+KKT+QAL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 13. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 217.5 bits 771,  Expect = 9e-59
 Identities = 106/131 80%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA+FPAFKPEE+A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGG+T+KKT QAL+IGIYDEP+TPGQCN+V+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQGL 131
            +LGDYLIEQG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 14. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 216.7 bits 768,  Expect = 2e-58
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDI+GN LT+AAI+GQDGSVW+QSA+FP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG+GGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDY+IEQGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 15. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 216.7 bits 768,  Expect = 2e-58
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSA+FP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 16. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 216.4 bits 767,  Expect = 2e-58
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+IDG  LTAAAI+G+DGSVW+QS+SFP FKPEEIAAI+KDFD+PG+L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG+GGIT+KKT QAL+ GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 17. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 216.2 bits 766,  Expect = 2e-58
 Identities = 105/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDI+GN LT+AAI+G+DGSVW+ SASFP F  EE++AI+KDF++PG+L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPGAVIRGKKGSGG+T+KKT+QAL+IG+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 18. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 214.5 bits 760,  Expect = 7e-58
 Identities = 103/131 78%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G+DGSVW+QSA+FP +KPEE+  IL DF++PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KK++ ALLIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 19. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 214.2 bits 759,  Expect = 9e-58
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCD++GNRLTAAAILGQDGSVW+QSA+FP +KPEEI  I  DF +PGTL
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLF+GGTKYMVIQGEP AVIRGKKG+GG+TIKKT+QA++ GIY+EP+TPGQCN+VVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 20. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 214.0 bits 758,  Expect = 1e-57
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+CDIDG  LTAAAI+G+DGSVW+QS +FP  KPEEIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGSGG+TIKKT+ AL+IGIY+EP+TPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL +QG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 21. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 213.7 bits 757,  Expect = 1e-57
 Identities = 104/130 80%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+GQDGSVW+QSA+FP FK EEI  I+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GG+T+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 213.7 bits 757,  Expect = 1e-57
 Identities = 109/130 83%, Positives = 122/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQAYVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI++DFD+PG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGL LGGTKYMVIQGEPGAVIRGKKG+GGI +KKT QAL++GIYDEPVTPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 23. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 213.4 bits 756,  Expect = 2e-57
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDD LMCDIDG+ LTAAAILG+DGSVW++S++FP FKPEEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+ GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 24. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 213.1 bits 755,  Expect = 2e-57
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+CDI+G  L+AAAI+G+DGSVW+QS +FP +KPEE+A ++KDFD+PGTL
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLF+GGTKYMVIQGEPG VIRGKKG+GGITIKKT  +L+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 25. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 212.9 bits 754,  Expect = 2e-57
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA+FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 26. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 212.6 bits 753,  Expect = 3e-57
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVD+HLMC+I+G  L+AAAI+G+DGSVW+QS SFP +KPEE+A I+KDFD+PGTL
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLF+GGTKYMVIQGEPG VIRGKKG+GGITIKKT  +L+IG+YDEP+TPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 27. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 212.6 bits 753,  Expect = 3e-57
 Identities = 102/131 77%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAY D+HLMC+I+GNRL AAAI+G+DGSVW+QS++FP +KPEEI  ++ DF++PG+L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKTSQAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 28. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 212.3 bits 752,  Expect = 3e-57
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVDDHLMC+I+G  N L+AAAILG DGSVW+QSASFP FKP+EI+A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKT QAL+IGIYDEPVTPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 29. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 212.1 bits 751,  Expect = 4e-57
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKT  AL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            R GDYLI+QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 30. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 212.1 bits 751,  Expect = 4e-57
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G++GSVW+QSA+FP +KPEE+  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KK++ ALLIGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 211.8 bits 750,  Expect = 5e-57
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN LT+AAI+GQDGSVW++S +FP +KPEEI  IL DF++PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL++GG+KYMVIQGEPGAVIRGKKG GG+T+KKT+ AL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 32. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 211.8 bits 750,  Expect = 5e-57
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS +FP FKPEE+AAI+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGIT+KKT Q+L+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 33. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 211.5 bits 749,  Expect = 6e-57
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQ YVDDHLMC++DGN   +L+AAAI+G+DGSVW+QS++FP FKPEEI  I+K+FD+P
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            G LAPTGL+LGGTKYMVIQGEP AVIRGKKGSGG+TIKKT QAL+ G+YDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIEQGL 131
            +VERLGDYLIEQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 34. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 211.5 bits 749,  Expect = 6e-57
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQAYVDDHLMC+++GN    LTAAAI+G+DGSVW+QS++FP  KPEEIA I+KDFD+P
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            G LAPTGL+LGG KYMVIQGEP AVIRGKKGSGG+TIKKT QAL+ G+YDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIEQGL 131
            +VERLGDYLI+QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 35. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 211.2 bits 748,  Expect = 7e-57
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS SFP +KPEE++AI+KDF++PG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT+QAL+IGIY EP+TPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            R+GDYL+EQG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 36. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 211.2 bits 748,  Expect = 7e-57
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVD+HLMC+IDG+ LTAAAILG+DGSVW+QS+SFP FK EEI  I+ DF++PG+L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT+QAL+ GIY+EP+TPGQCN+VVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 37. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 211.0 bits 747,  Expect = 9e-57
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+C I+GN LT AAI+GQDGSVW QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKT  AL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 38. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 210.4 bits 745,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSW+AYVDDHL C+IDG  LT+AAILG+DGSVW+QS +FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT  AL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 210.4 bits 745,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL C+IDG  LT+AAILG+DGSVW++S +FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT  AL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 210.1 bits 744,  Expect = 2e-56
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+IDG  L++AAILG+D +VW+QS +FP FKPEEI+AIL DF+ PG+L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GGIT+KKT+ AL+IG+YDEP+TPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 41. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 209.6 bits 742,  Expect = 2e-56
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTG+F+ G KYMVIQGEPGAVIRGKKG+GGITIKKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 42. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 209.3 bits 741,  Expect = 3e-56
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS +FP FKPEEIA I+KDFD+PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT   L++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 43. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 209.3 bits 741,  Expect = 3e-56
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DGSVW++S +FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT  AL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 209.0 bits 740,  Expect = 3e-56
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSA+FP FKPEE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            G LAPTGL LGGTKYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 45. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 209.0 bits 740,  Expect = 3e-56
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSA+FP FKPEE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            G LAPTGL LGGTKYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            VVERLGDYL+EQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 46. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 208.8 bits 739,  Expect = 4e-56
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS +FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            AP GLFLG TKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 47. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 208.8 bits 739,  Expect = 4e-56
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA+FP FKP+EIAAI+K+FD+PG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKT QAL+ GIYDEPVTPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 48. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 208.2 bits 737,  Expect = 6e-56
 Identities = 100/131 76%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ Y D+HLMC+I+GNRL AAAI+G+DGSVW+QS++FP +KPEEI  ++ DF++PG+L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGAVIR KKG GG+T+KKTSQAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 49. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 208.2 bits 737,  Expect = 6e-56
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+ LMC+I+GN LTAAAI+GQDGSVW+QS++FP FK EEI AI+ DFD+PGTL
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GG+T++KT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 50. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 207.9 bits 736,  Expect = 7e-56
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS +FP +KPEE+A I+ DF  PGTL
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GG+T+KKT  AL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 51. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 207.9 bits 736,  Expect = 8e-56
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSW+AYVDDHL C+IDG  LT+AAILG+DGSVW+QS +FP FKPEE A I+KDF++PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT  AL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 52. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 207.7 bits 735,  Expect = 9e-56
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG+GGITIKKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 53. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 207.7 bits 735,  Expect = 9e-56
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG+GGITIKKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 54. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 207.7 bits 735,  Expect = 9e-56
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSA+FP FKPEE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            G LAPTGL LGGTKYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            V ERLGDYL+EQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 55. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 207.1 bits 733,  Expect = 1e-55
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQAYVD+HLMC+I+G+ L AAAI+G+DG+ W+QS +FP FK E++A I+KDFD+PG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 56. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 207.1 bits 733,  Expect = 1e-55
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSASFP +KPEEI  I+KDFD+PG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 57. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 206.8 bits 732,  Expect = 2e-55
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            M WQ YVDDHLMC+I+G  N L+ AAILG DGSVW+QSASFP FKP+EIAA++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGL LGGTKYMVIQGEPG  IRGKKG GGI +KKT QAL+ GIYDEPVTPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 58. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 206.3 bits 730,  Expect = 2e-55
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA+FP FKPEEI  I+ DF  PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GGITIKKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 59. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 206.3 bits 730,  Expect = 2e-55
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA+FP FKPEEI  I+ DF  PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GGITIKKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 60. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 206.0 bits 729,  Expect = 3e-55
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSA+FP FKPEEI  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            GTLAPTGL LGGTKYMVIQGE GAVIRGKKGSGGITIKKT+QAL+ GIY+EPVTPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            VV RLGD L++QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 61. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 204.4 bits 723,  Expect = 8e-55
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAI+G+DG+VW+QSA FP FKPEEI  I+KD+D+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGITIKKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 62. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 204.1 bits 722,  Expect = 1e-54
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVDDHLMC+I+G  N LTAAAILG DGSVW+QSA+FP FKP+EI+A++K+FD+ G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKT QAL+ GIYDEPVTPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 63. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 203.8 bits 721,  Expect = 1e-54
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVD+HLMCDIDG    L AAAI+G+DGSVW+QS++FP FK EEI+ I+KDF++PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
             LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG+TIKKTSQAL+ GIY+EPVTPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 64. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 203.3 bits 719,  Expect = 2e-54
 Identities = 98/130 75%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP +KP EI AIL DF++PG+L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKGSGG+TIKK++ AL+ G+YDEP+TPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 65. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 203.3 bits 719,  Expect = 2e-54
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGT 59
            MSWQAYVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA+FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVV 119
            LAPTGLFLGGTKYMVIQGE GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQGL 131
            ERLGDYL+EQGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 66. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 202.7 bits 717,  Expect = 3e-54
 Identities = 97/131 74%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP FKPEEI AI+ DF +PG+L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKG GG+TI+KT+QAL+IGIYD+P+TPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 67. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 202.7 bits 717,  Expect = 3e-54
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ+YVDDHLMCD++GN LTAAAILGQDGSVW+QSA FP +KP+EI  I KDF++PG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
            APTGLFLGG KYMVIQGE GAVIRGKKG GG+TIKKT+QAL+ G YDEP+T GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIE  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 68. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 201.4 bits 712,  Expect = 7e-54
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS+SFP +K +EI  I KDF++PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
             LAPTGL L GTKYMVIQGEPGAVIRGKKGSGG+TIKKT QAL+ GIY+EPVTPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 69. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 201.1 bits 711,  Expect = 8e-54
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQAYVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP FKPEE+  I+K+FD+ G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTG+F+ G KYMV+QGEPGAVIRGKKG+GGI IKKT QA+++GIYDEPV PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 70. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 201.1 bits 711,  Expect = 8e-54
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 4/130 3%
Query  1    MSWQAYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
            MSWQ YVD+HLMCDIDG   N L A+AI+G+DGSVW+QS+SFP FKP+EI  I+KDF++P
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSL-ASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
            G LAPTGL LGG KYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  VVERLGDYLIEQGL 131
            VVERLGDYLI+QGL
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 71. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 200.5 bits 709,  Expect = 1e-53
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQAYVD+HLMC+I+  GN LT++AI+G DGS+W+QS++FP  KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGLFLGG KYMVIQGEPGAVIRGKKG GG+ IKKT+QAL+ GIYDEPV PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYLIEQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 72. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 199.7 bits 706,  Expect = 2e-53
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGT 59
            MSWQAYVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA+FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVV 119
            LAPTGLFLGGTKYMVIQGE GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQGL 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 73. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 197.0 bits 696,  Expect = 1e-52
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDI+G    LT+AAI+G DG+VW++SASFP FKP EI AI+K+F++ G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
             LAPTGLFLGG KYMVIQGE GAVIRGKKG+GGI IKKT QA++ GIYDEPV PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 192.6 bits 680,  Expect = 3e-51
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP FKPEE+  I+ +F++ G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
            TLAPTGLFLGG KYMV+QGE GAVIRGKKG+GGI IKKT QA+++GIYDEPV PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 179.2 bits 631,  Expect = 3e-47
 Identities = 88/109 80%, Positives = 101/109 92%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMC+I+GN LT+AAI+GQDGS+W+QSASFP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEP 109
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKT+QAL+IGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 148.9 bits 521,  Expect = 5e-38
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 28/130 21%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPA------------------- 41
            MSWQ YVDDHLMCD++G+ L +AAILG DGSVW+QS +FP                    
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGI 92
                     FKPEEI  I+KDFD+PG LAPTGLFLGGTKYMVIQGEPGAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLIEQG 130
            TIKKT QAL+ GIY+EPVTPGQCN+VVE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 79.4 bits 267,  Expect = 3e-17
 Identities = 50/123 40%, Positives = 74/123 60%, Gaps = 6/123 4%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQ-SASFPA-FKPEEIAAILKDF-DQP 57
            MSWQ+YVD+++   +D  RL   A L QDG+VW++    +P     +E+  I       P
Sbjct  1    MSWQSYVDNQICQHVD-CRLAVIAGL-QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
             ++   G+ LGG KY+ IQ +  +++RG+KGS  + I  T+  LL     +   PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  VVERLGDYL 126
            VVE+LGDYL
Sbjct  118  VVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.