The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL
APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE
RLGDYLIEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
P84177 Cit s 2.0101 131 873 258.9 3.2e-71
CAD37201 Pru p 4.0101 131 854 253.4 1.5e-69
AY081852 Pru du 4.0102 131 848 251.7 4.9e-69
AY081850 Pru du 4.0101 131 848 251.7 4.9e-69
Q9XF39 Pru av 4 131 847 251.4 5.9e-69
Q9XF42 Mal d 4 131 825 245.0 4.9e-67
Q9LEI8 Hev b 8.0204 131 773 230.0 1.7e-62
CAD10376 Cap a 2 131 772 229.7 2e-62
Q9M7M8 Hev b 8.0203 131 771 229.4 2.5e-62
Q9M7M9 Hev b 8.0202 131 769 228.8 3.7e-62
Q9XF38 Pyr c 4 131 769 228.8 3.7e-62
AAL29690 Lyc e 1 131 768 228.5 4.5e-62
Q9M7N0 Hev b 8.0201 131 766 227.9 6.7e-62
QID21357 Pop n 2.0101 131 765 227.7 8.2e-62
A0A2I4DNN6 Jug r 7.0101 131 761 226.5 1.8e-61
Q9STB6 Hev b 8.0102 131 752 223.9 1.1e-60
Q9XF40 Mal d 4 131 752 223.9 1.1e-60
O65812 Hev b 8.0101 131 749 223.0 2e-60
O04725 Cyn d 12 131 746 222.2 3.7e-60
AAL07320 Lit c 1 131 746 222.2 3.7e-60
Q8L5D8 Pho d 2.0101 131 739 220.1 1.5e-59
AF377948 Mus a 1.0101 131 737 219.6 2.3e-59
CAD37202 Pru p 4.0201 131 733 218.4 5.1e-59
ACP43298 Ama r 2.0101 133 733 218.4 5.2e-59
A0A0A0REA1 Koc s 2.0101 133 732 218.1 6.3e-59
ABU95412 Sin a 4.0101 131 730 217.5 9.2e-59
Q9AXH4 Cor a 2 131 730 217.5 9.2e-59
Q9FUD1 Ory s 12.0101 131 729 217.2 1.1e-58
Q9FR39 Zea m 12.0105 131 728 216.9 1.4e-58
O24169 Ole e 2 134 728 216.9 1.4e-58
O24170 Ole e 2 134 728 216.9 1.4e-58
O65809 Gly m 3 131 726 216.4 2.1e-58
A0A023W2L7 Pro j 2.0101 133 726 216.4 2.1e-58
AAL92870 Che a 2 131 725 216.1 2.5e-58
Q5XWE1 Citr l 2.0101 131 725 216.1 2.5e-58
AAK54835 Ana c 1 131 725 216.1 2.5e-58
O22655 Zea m 12.0104 131 724 215.8 3.1e-58
O24171 Ole e 2 134 723 215.5 3.9e-58
QRN65366 Lig v 2.0101 134 723 215.5 3.9e-58
Q9XF41 Mal d 4 131 722 215.2 4.6e-58
P35082 Zea m 12.0102 131 722 215.2 4.6e-58
O65810 Gly m 3 131 722 215.2 4.6e-58
P35081 Zea m 12.0101 131 721 214.9 5.6e-58
AAL76933 Dau c 4 134 718 214.0 1.1e-57
O24650 Phl p 12.0102 131 715 213.2 1.9e-57
ACS34771 Sal k 4.0101 133 715 213.2 1.9e-57
AAK01235 Cor a 2 131 714 212.9 2.3e-57
FM164277 Tri a 12.0104 131 714 212.9 2.3e-57
P35083 Zea m 12.0103 131 714 212.9 2.3e-57
QVU02258 Que ac 2.0101 133 714 212.9 2.3e-57
Q9XF37 Api g 4 134 714 212.9 2.4e-57
P49233 Tri a 12.0102 141 714 212.8 2.5e-57
AAP13533 Cuc m 2 131 713 212.6 2.8e-57
CAD10377 Lyc e 1 131 711 212.0 4.2e-57
Q93YG7 Sola l 1.0101 131 711 212.0 4.2e-57
O49894 Mer a 1 133 711 212.0 4.3e-57
P52184 Hor v 12.0101 131 710 211.7 5.1e-57
P49232 Tri a 12.0101 138 710 211.7 5.5e-57
CAA54686 Phl p 12.0101 131 708 211.2 7.6e-57
P35079 Phl p 12.0101 131 708 211.2 7.6e-57
A0A0A0RCW1 Aca f 2 133 706 210.6 1.2e-56
P49234 Tri a 12.0103 140 705 210.2 1.5e-56
Q42449 Ara t 8 131 703 209.7 2.1e-56
Q9XG85 Par j 3 132 701 209.1 3.1e-56
Q9SQI9 Ara h 5 131 698 208.3 5.6e-56
O24282 Phl p 12.0103 131 696 207.7 8.4e-56
Q5EF31 Cro s 1.0101 131 693 206.8 1.5e-55
P25816 Bet v 2 133 693 206.8 1.6e-55
XP030492464 Can s 2.0101 133 690 205.9 2.9e-55
Q9T0M8 Par j 3 131 688 205.4 4.2e-55
AJ421030 Art v 4.0101 133 683 203.9 1.2e-54
O81982 Hel a 2 133 683 203.9 1.2e-54
ADK22841 Sal k 4.0201 133 679 202.8 2.6e-54
AJ421031 Art v 4.0201 133 671 200.4 1.3e-53
FG438715 Act d 9.0101 109 621 186.1 2.2e-49
QEQ43417 Sola m 1.0101 159 491 148.2 8e-38
A0A1B2YLJ4 Tyr p 36.0101 131 268 83.9 1.6e-18
C0HJX6 Pla l 2.0101 42 79 29.9 0.0087
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 258.9 bits 873,  Expect = 3e-71
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 2. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 253.4 bits 854,  Expect = 1e-69
 Identities = 128/131 97%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAF+ EEIAAILKDFDQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGI VKKTNQALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 3. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 251.7 bits 848,  Expect = 5e-69
 Identities = 127/131 96%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAF+ EEIAAILKDFDQPGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGI VKKTNQALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 4. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 251.7 bits 848,  Expect = 5e-69
 Identities = 127/131 96%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAF+ EEIAAILKDFDQPGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGI VKKTNQALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 5. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 251.4 bits 847,  Expect = 6e-69
 Identities = 127/131 96%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAF+ EEIAAILKD+DQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGI VKKTNQALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 6. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 245.0 bits 825,  Expect = 5e-67
 Identities = 120/131 91%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSA+FPAF+ EEIAAILKDFDQPGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGGI +KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 7. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 230.0 bits 773,  Expect = 2e-62
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP F+ +E+AA++KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGI VKKT QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 8. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 229.7 bits 772,  Expect = 2e-62
 Identities = 112/131 85%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSATFP F+ EEI AI+ DF +PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGI VKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 9. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 229.4 bits 771,  Expect = 2e-62
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS+ FP F+ +E+AA++KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGI VKKT QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 228.8 bits 769,  Expect = 4e-62
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP F+ +E+AAI+KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGI VKKT+QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 11. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 228.8 bits 769,  Expect = 4e-62
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMCDIDG+ LTAAAILG+DGSVW+QS+TFP F+ EEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+ VKKT+QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 12. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 228.5 bits 768,  Expect = 5e-62
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDI+GN LT+AAI+GQDGSVW+QSA FP F+ EEI AI+ DF +PGTL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGEAGAVIRGKKG+GGI VKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDY+IEQGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 227.9 bits 766,  Expect = 7e-62
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMCDIDG+ LTAAAI+G+DGSVW+QS++FP F+ EE+AAI+KDFD+PG+L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGI VKKT QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 14. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 227.7 bits 765,  Expect = 8e-62
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDI+GN LT+AAI+G+DGSVW+ SA+FP F  EE++AI+KDF++PG+L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE GAVIRGKKGSGG+ VKKTNQALIIG+YDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 15. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 226.5 bits 761,  Expect = 2e-61
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+IDG  LTAAAI+G+DGSVW+QS++FP F+ EEIAAI+KDFD+PG+L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGEAGAVIRGKKG+GGI VKKT QALI GIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 16. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 223.9 bits 752,  Expect = 1e-60
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+GQDGSVW+QSA FP F+ EEI  I+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+ VKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 17. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 223.9 bits 752,  Expect = 1e-60
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDD LMCDIDG+ LTAAAILG+DGSVW++S+TFP F+ EEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+ VKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 18. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 223.0 bits 749,  Expect = 2e-60
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+ LMC+I+GN LTAAAI+GQDGSVW+QS+ FP F+ EEI AI+ DFD+PGTL
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGEAGAVIRGKKG GG+ V+KTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 19. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 222.2 bits 746,  Expect = 4e-60
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA FPAF+ EE+A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGG+ VKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQGL 131
            +LGDYLIEQG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 20. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 222.2 bits 746,  Expect = 4e-60
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA FP F+  EIAAI+KDFD+PG+L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGI VKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 21. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 220.1 bits 739,  Expect = 2e-59
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVD+HLMC+IDG+ LTAAAILG+DGSVW+QS++FP F+ EEI  I+ DF++PG+L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGG+ VKKTNQALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 22. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 219.6 bits 737,  Expect = 2e-59
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+CDIDG  LTAAAI+G+DGSVW+QS  FP  + EEIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGG+ +KKTN ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL +QG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 23. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 218.4 bits 733,  Expect = 5e-59
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G+DGSVW+QSATFP ++ EE+  IL DF++PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKK+  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 24. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 218.4 bits 733,  Expect = 5e-59
 Identities = 108/130 83%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQAYVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP F+ +EIAAI++DFD+PG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGL LGGTKYMVIQGE GAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 25. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 218.1 bits 732,  Expect = 6e-59
 Identities = 108/131 82%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA FP F+ +EIAAI+K+FD+PG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 26. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 217.5 bits 730,  Expect = 9e-59
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCD++GNRLTAAAILGQDGSVW+QSA FP ++ EEI  I  DF +PGTL
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLF+GGTKYMVIQGE  AVIRGKKG+GG+ +KKT QA++ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 27. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 217.5 bits 730,  Expect = 9e-59
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAY D+HLMC+I+GNRL AAAI+G+DGSVW+QS+TFP ++ EEI  ++ DF++PG+L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 28. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 217.2 bits 729,  Expect = 1e-58
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA FP F+ EE+  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGI VKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 29. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 216.9 bits 728,  Expect = 1e-58
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+CDI+G  L+AAAI+G+DGSVW+QS  FP ++ EE+A ++KDFD+PGTL
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGI +KKT  +LIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 30. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 216.9 bits 728,  Expect = 1e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSATFP F+ EE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQGL 131
            +VERLGDYL+EQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 31. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 216.9 bits 728,  Expect = 1e-58
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSATFP F+ EE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQGL 131
            +VERLGDYL+EQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 32. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 216.4 bits 726,  Expect = 2e-58
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+CDI+GN LT AAI+GQDGSVW+QS  FP F+ EEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            R GDYLI+QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 216.4 bits 726,  Expect = 2e-58
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVDDHLMC+I+G  N L+AAAILG DGSVW+QSA+FP F+ +EI+A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGL LGGTKYMVIQGE G VIRGKKG GGI VKKT QALIIGIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 34. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 216.1 bits 725,  Expect = 3e-58
 Identities = 98/131 74%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS +FP ++ EE++AI+KDF++PG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+ +KKTNQALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            R+GDYL+EQG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 35. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 216.1 bits 725,  Expect = 3e-58
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN LT+AAI+GQDGSVW++S  FP ++ EEI  IL DF++PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL++GG+KYMVIQGE GAVIRGKKG GG+ VKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 36. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 216.1 bits 725,  Expect = 3e-58
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+IDG  L++AAILG+D +VW+QS  FP F+ EEI+AIL DF+ PG+L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GGI VKKTN ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 37. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 215.8 bits 724,  Expect = 3e-58
 Identities = 99/131 75%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVD+HLMC+I+G  L+AAAI+G+DGSVW+QS +FP ++ EE+A I+KDFD+PGTL
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGI +KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 38. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 215.5 bits 723,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSATFP F+ EE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQGL 131
            + ERLGDYL+EQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 39. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 215.5 bits 723,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQAYVDDHLMCDI+G+   RLTAAAI+G+DGSVW+QSATFP F+ EEI  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            GTLAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGI +KKTNQAL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQGL 131
            +V RLGD L++QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 40. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 215.2 bits 722,  Expect = 5e-58
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G++GSVW+QSATFP ++ EE+  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+ VKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 215.2 bits 722,  Expect = 5e-58
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVD+HLMC+I+G+ L AAAI+G+DG+ W+QS  FP F+ E++A I+KDFD+PG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGI VKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 42. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 215.2 bits 722,  Expect = 5e-58
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL+C I+GN LT AAI+GQDGSVW QS  FP F+ EEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 43. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 214.9 bits 721,  Expect = 6e-58
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS  FP F+ EE+AAI+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGI VKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 44. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 214.0 bits 718,  Expect = 1e-57
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQ YVDDHLMC++DGN   +L+AAAI+G+DGSVW+QS+TFP F+ EEI  I+K+FD+P
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKGSGG+ +KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLIEQGL 131
            IVERLGDYLIEQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 45. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 213.2 bits 715,  Expect = 2e-57
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP F+ EEI  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG+GGI +KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 46. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 213.2 bits 715,  Expect = 2e-57
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVDDHLMC+I+G  N LTAAAILG DGSVW+QSA FP F+ +EI+A++K+FD+ G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 47. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 212.9 bits 714,  Expect = 2e-57
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ Y D+HLMC+I+GNRL AAAI+G+DGSVW+QS+TFP ++ EEI  ++ DF++PG+L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIR KKG GG+ VKKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 48. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 212.9 bits 714,  Expect = 2e-57
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSW+AYVDDHL C+IDG  LT+AAILG+DGSVW+QS  FP F+ EEIA I+KDF++PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 49. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 212.9 bits 714,  Expect = 2e-57
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS  FP F+ EE+  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            AP GLFLG TKYMVIQGE GAVIRGKKGSGGI VKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 50. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 212.9 bits 714,  Expect = 2e-57
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVD+HLMCDIDG    L AAAI+G+DGSVW+QS+ FP F+ EEI+ I+KDF++PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
             LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGG+ +KKT+QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 51. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 212.9 bits 714,  Expect = 2e-57
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQAYVDDHLMC+++GN    LTAAAI+G+DGSVW+QS+TFP  + EEIA I+KDFD+P
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+ +KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLIEQGL 131
            IVERLGDYLI+QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 52. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 212.8 bits 714,  Expect = 3e-57
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQAYVDDHL C+IDG  LT+AAILG+DGSVW++S  FP F+ EEIA I+KDF++PG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 53. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 212.6 bits 713,  Expect = 3e-57
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS  FP ++ EE+A I+ DF  PGTL
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+ VKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 54. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 212.0 bits 711,  Expect = 4e-57
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP F+ EEI  I+ DF  PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGI +KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 55. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 212.0 bits 711,  Expect = 4e-57
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP F+ EEI  I+ DF  PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGI +KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 56. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 212.0 bits 711,  Expect = 4e-57
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSA+FP ++ EEI  I+KDFD+PG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
             LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 57. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 211.7 bits 710,  Expect = 5e-57
 Identities = 99/131 75%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS  FP F+ EEIA I+KDFD+PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 58. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 211.7 bits 710,  Expect = 5e-57
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DGSVW++S  FP F+ EEIA I+KDF++PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 59. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 211.2 bits 708,  Expect = 8e-57
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP F+ EEI  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTG+F+ G KYMVIQGE G VIRGKKG+GGI +KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 60. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 211.2 bits 708,  Expect = 8e-57
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP F+ EEI  I+KDFD+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTG+F+ G KYMVIQGE G VIRGKKG+GGI +KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 61. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 210.6 bits 706,  Expect = 1e-56
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            M WQ YVDDHLMC+I+G  N L+ AAILG DGSVW+QSA+FP F+ +EIAA++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGL LGGTKYMVIQGE G  IRGKKG GGI VKKT QAL+ GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 62. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 210.2 bits 705,  Expect = 2e-56
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSW+AYVDDHL C+IDG  LT+AAILG+DGSVW+QS  FP F+ EE A I+KDF++PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 63. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 209.7 bits 703,  Expect = 2e-56
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ+YVDDHLMCD++GN LTAAAILGQDGSVW+QSA FP ++ +EI  I KDF++PG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKTNQAL+ G YDEP+T GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIE  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 64. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 209.1 bits 701,  Expect = 3e-56
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGT 59
            MSWQAYVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA FP ++ EE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIV 119
            LAPTGLFLGGTKYMVIQGE+GAVIRGKKGSGG  +KKT QA++IGIYDEP+TPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQGL 131
            ERLGDYL+EQGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 65. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 208.3 bits 698,  Expect = 6e-56
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP F+ EEI AI+ DF +PG+L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+ ++KTNQALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 66. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 207.7 bits 696,  Expect = 8e-56
 Identities = 93/131 70%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMC+I+G+ L +AAI+G+DG+VW+QSA FP F+ EEI  I+KD+D+PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTG+F+   KYMVIQGE GAVIRGKKG+GGI +KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 67. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 206.8 bits 693,  Expect = 2e-55
 Identities = 94/130 72%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP ++  EI AIL DF++PG+L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGG+ +KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 68. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 206.8 bits 693,  Expect = 2e-55
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 4/130 3%
Query  1    MSWQAYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
            MSWQ YVD+HLMCDIDG   N L A+AI+G+DGSVW+QS++FP F+ +EI  I+KDF++P
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSL-ASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
            G LAPTGL LGG KYMVIQGEAGAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  IVERLGDYLIEQGL 131
            +VERLGDYLI+QGL
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 69. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 205.9 bits 690,  Expect = 3e-55
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS++FP ++ +EI  I KDF++PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG+ +KKT QALI GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 70. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 205.4 bits 688,  Expect = 4e-55
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGT 59
            MSWQAYVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA FP ++ EE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIV 119
            LAPTGLFLGGTKYMVIQGE+GAVI GKKGSGG  +KKT QA++IGIYDEP+TPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQGL 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 71. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 203.9 bits 683,  Expect = 1e-54
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDI+G    LT+AAI+G DG+VW++SA+FP F+  EI AI+K+F++ G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
             LAPTGLFLGG KYMVIQGEAGAVIRGKKG+GGI +KKT QA++ GIYDEP+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 72. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 203.9 bits 683,  Expect = 1e-54
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQAYVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP F+ EE+  I+K+FD+ G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTG+F+ G KYMV+QGE GAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 202.8 bits 679,  Expect = 3e-54
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQAYVD+HLMC+I+  GN LT++AI+G DGS+W+QS+ FP  + +EI AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYLIEQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 200.4 bits 671,  Expect = 1e-53
 Identities = 94/131 71%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP F+ EE+  I+ +F++ G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
            TLAPTGLFLGG KYMV+QGEAGAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 186.1 bits 621,  Expect = 2e-49
 Identities = 88/109 80%, Positives = 100/109 91%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
            MSWQ YVDDHLMC+I+GN LT+AAI+GQDGS+W+QSA+FP F+ EEI AI+ DF +PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEP 109
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GG+ VKKTNQALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 148.2 bits 491,  Expect = 8e-38
 Identities = 98/130 75%, Positives = 114/130 87%, Gaps = 28/130 21%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPA------------------- 41
            MSWQ YVDDHLMCD++G+ L +AAILG DGSVW+QS  FP                    
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FRLEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGI 92
                     F+ EEI  I+KDFD+PG LAPTGLFLGGTKYMVIQGE GAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   IVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLIEQG 130
             +KKT QALI GIY+EP+TPGQCNM+VE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 83.9 bits 268,  Expect = 2e-18
 Identities = 48/123 39%, Positives = 75/123 60%, Gaps = 6/123 4%
Query  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQ-SATFPA-FRLEEIAAILKDF-DQP 57
            MSWQ+YVD+++   +D  RL   A L QDG+VW++    +P     +E+  I       P
Sbjct  1    MSWQSYVDNQICQHVD-CRLAVIAGL-QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
             ++   G+ LGG KY+ IQ +  +++RG+KGS  + +  TN  L+     + + PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  IVERLGDYL 126
            +VE+LGDYL
Sbjct  118  VVEKLGDYL 126

Sequence Alignment: 78. Allergen Name: Pla l 2.0101 Sequence ID: C0HJX6

 Score = 29.9 bits 79,  Expect = 0.009
 Identities = 27/32 84%, Positives = 28/32 87%, Gaps = 29/32 90%
Query  24   AILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVI 83
            AILGQDGSVW+Q                            GL LGG KY VI GE GAVI
Sbjct  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
Query  84   R 84
            R
Sbjct  32   R 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.