The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP
GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
VVERLGDYLLEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
O24170 Ole e 2 134 922 235.0 5.4e-64
O24171 Ole e 2 134 917 233.7 1.3e-63
O24169 Ole e 2 134 907 231.3 7e-63
QRN65366 Lig v 2.0101 134 860 219.7 2.2e-59
O49894 Mer a 1 133 800 204.9 6.1e-55
Q9XF37 Api g 4 134 798 204.4 8.6e-55
P25816 Bet v 2 133 796 203.9 1.2e-54
AAL76933 Dau c 4 134 793 203.2 2e-54
Q9XF38 Pyr c 4 131 789 202.2 3.9e-54
QVU02258 Que ac 2.0101 133 789 202.2 4e-54
Q9M7N0 Hev b 8.0201 131 781 200.2 1.5e-53
Q9XF40 Mal d 4 131 781 200.2 1.5e-53
Q9LEI8 Hev b 8.0204 131 776 199.0 3.6e-53
A0A2I4DNN6 Jug r 7.0101 131 775 198.7 4.3e-53
Q9M7M8 Hev b 8.0203 131 774 198.5 5.1e-53
XP030492464 Can s 2.0101 133 768 197.0 1.4e-52
Q9M7M9 Hev b 8.0202 131 763 195.8 3.3e-52
AAL29690 Lyc e 1 131 760 195.0 5.5e-52
Q9FUD1 Ory s 12.0101 131 760 195.0 5.5e-52
Q8L5D8 Pho d 2.0101 131 759 194.8 6.6e-52
P35081 Zea m 12.0101 131 755 193.8 1.3e-51
O04725 Cyn d 12 131 755 193.8 1.3e-51
A0A0A0REA1 Koc s 2.0101 133 752 193.1 2.2e-51
CAD10376 Cap a 2 131 751 192.8 2.6e-51
CAD37201 Pru p 4.0101 131 751 192.8 2.6e-51
Q9AXH4 Cor a 2 131 751 192.8 2.6e-51
O24650 Phl p 12.0102 131 750 192.6 3.1e-51
ACP43298 Ama r 2.0101 133 750 192.6 3.1e-51
CAD37202 Pru p 4.0201 131 747 191.8 5.1e-51
P35082 Zea m 12.0102 131 745 191.3 7.2e-51
AY081852 Pru du 4.0102 131 745 191.3 7.2e-51
AY081850 Pru du 4.0101 131 745 191.3 7.2e-51
Q9XF41 Mal d 4 131 744 191.1 8.5e-51
Q9XF39 Pru av 4 131 744 191.1 8.5e-51
P35079 Phl p 12.0101 131 743 190.9 1e-50
CAA54686 Phl p 12.0101 131 743 190.9 1e-50
ABU95412 Sin a 4.0101 131 742 190.6 1.2e-50
Q9XG85 Par j 3 132 742 190.6 1.2e-50
ACS34771 Sal k 4.0101 133 742 190.6 1.2e-50
AAL07320 Lit c 1 131 741 190.4 1.4e-50
P35083 Zea m 12.0103 131 741 190.4 1.4e-50
Q9XF42 Mal d 4 131 740 190.1 1.7e-50
AAK01235 Cor a 2 131 735 188.9 4e-50
Q9STB6 Hev b 8.0102 131 735 188.9 4e-50
AAL92870 Che a 2 131 735 188.9 4e-50
A0A023W2L7 Pro j 2.0101 133 735 188.9 4e-50
O24282 Phl p 12.0103 131 733 188.4 5.6e-50
O65809 Gly m 3 131 730 187.6 9.3e-50
O65812 Hev b 8.0101 131 730 187.6 9.3e-50
AJ421030 Art v 4.0101 133 730 187.6 9.4e-50
Q9T0M8 Par j 3 131 729 187.4 1.1e-49
P84177 Cit s 2.0101 131 728 187.2 1.3e-49
QID21357 Pop n 2.0101 131 728 187.2 1.3e-49
FM164277 Tri a 12.0104 131 727 186.9 1.6e-49
Q9FR39 Zea m 12.0105 131 727 186.9 1.6e-49
AF377948 Mus a 1.0101 131 727 186.9 1.6e-49
Q5XWE1 Citr l 2.0101 131 725 186.4 2.2e-49
A0A0A0RCW1 Aca f 2 133 724 186.2 2.6e-49
O65810 Gly m 3 131 723 185.9 3.1e-49
O22655 Zea m 12.0104 131 723 185.9 3.1e-49
P49234 Tri a 12.0103 140 723 185.9 3.3e-49
P49233 Tri a 12.0102 141 722 185.7 3.9e-49
O81982 Hel a 2 133 719 184.9 6.2e-49
P52184 Hor v 12.0101 131 717 184.4 8.6e-49
AJ421031 Art v 4.0201 133 714 183.7 1.5e-48
P49232 Tri a 12.0101 138 712 183.2 2.1e-48
AAP13533 Cuc m 2 131 710 182.7 2.8e-48
AAK54835 Ana c 1 131 709 182.5 3.4e-48
Q93YG7 Sola l 1.0101 131 705 181.5 6.6e-48
CAD10377 Lyc e 1 131 705 181.5 6.6e-48
Q42449 Ara t 8 131 700 180.3 1.6e-47
Q5EF31 Cro s 1.0101 131 700 180.3 1.6e-47
Q9SQI9 Ara h 5 131 680 175.3 4.8e-46
ADK22841 Sal k 4.0201 133 677 174.6 8.1e-46
FG438715 Act d 9.0101 109 606 157.1 1.2e-40
QEQ43417 Sola m 1.0101 159 519 135.6 5.1e-34
A0A1B2YLJ4 Tyr p 36.0101 131 272 74.8 8.8e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 235.0 bits 922,  Expect = 5e-64
 Identities = 134/134 100%, Positives = 134/134 100%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 2. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 233.7 bits 917,  Expect = 1e-63
 Identities = 133/134 99%, Positives = 133/134 99%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  121  VVERLGDYLLEQGL 134
            V ERLGDYLLEQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 3. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 231.3 bits 907,  Expect = 7e-63
 Identities = 131/134 97%, Positives = 133/134 99%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDIEGHE HRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 4. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 219.7 bits 860,  Expect = 2e-59
 Identities = 125/134 93%, Positives = 129/134 96%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDIEGHE HRLTAAAIVGHDGSVWAQSATFPQFKPEE+NGIMTDFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT QALVFGIYEEPVTPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  121  VVERLGDYLLEQGL 134
            VV RLGD L++QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 5. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 204.9 bits 800,  Expect = 6e-55
 Identities = 113/133 84%, Positives = 127/133 95%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDI+G +G+ L AA+IVGHDGS+WAQSA+FPQ+KPEE+ GIM DF+EP
Sbjct  1    MSWQTYVDDHLMCDIDG-QGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  120  VVERLGDYLIEQGM 133

Sequence Alignment: 6. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 204.4 bits 798,  Expect = 9e-55
 Identities = 110/134 82%, Positives = 126/134 94%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC++EG+ G+ LTAAAI+GHDGSVWAQS+TFPQ KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 7. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 203.9 bits 796,  Expect = 1e-54
 Identities = 114/133 85%, Positives = 125/133 93%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMCDI+G+  + L A+AIVGHDGSVWAQS++FPQFKP+E+ GIM DF EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSL-ASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGLHLGG KYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL++QGL
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 8. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 203.2 bits 793,  Expect = 2e-54
 Identities = 108/134 80%, Positives = 128/134 95%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMC+++G+ G++L+AAAI+GHDGSVWAQS+TFP+FKPEE+ GIM +F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL+LGGTKYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 9. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 202.2 bits 789,  Expect = 4e-54
 Identities = 112/131 85%, Positives = 124/131 94%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDI+G   H LTAAAI+GHDGSVWAQS+TFP+FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIDG---HHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGG+T+KKT QALVFGIYEEP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 10. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 202.2 bits 789,  Expect = 4e-54
 Identities = 113/133 84%, Positives = 124/133 93%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMCDI+G +G+ L AAAI+GHDGSVWAQS+ FPQFK EE++ IM DF EP
Sbjct  1    MSWQTYVDEHLMCDIDG-QGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGG+TIKKT QALVFGIYEEPVTPGQCNM
Sbjct  60   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL++QGL
Sbjct  120  VVERLGDYLVDQGL 133

Sequence Alignment: 11. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 200.2 bits 781,  Expect = 2e-53
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMCDI+G   H LTAAAI+GHDGSVWAQS++FPQFKPEE+  IM DF+EP
Sbjct  1    MSWQTYVDEHLMCDIDG---HHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYLLEQG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 12. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 200.2 bits 781,  Expect = 2e-53
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDD LMCDI+G   H LTAAAI+GHDGSVWA+S+TFP+FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDRLMCDIDG---HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 199.0 bits 776,  Expect = 4e-53
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDI+G   HRLTAAAI+GHDGSVWAQS++FPQFK +E+  +M DF+EP
Sbjct  1    MSWQTYVDDHLMCDIDG---HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYLL+QGL
Sbjct  118  IVERLGDYLLDQGL 131

Sequence Alignment: 14. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 198.7 bits 775,  Expect = 4e-53
 Identities = 109/131 83%, Positives = 125/131 95%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+I+G   + LTAAAI+GHDGSVWAQS++FPQFKPEE+  IM DF+EP
Sbjct  1    MSWQTYVDEHLMCEIDG---QHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGEAGAVIRGKKG+GGIT+KKTGQAL+FGIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLVEQGL 131

Sequence Alignment: 15. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 198.5 bits 774,  Expect = 5e-53
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDI+G   HRLTAAAI+GHDGSVWAQS+ FPQFK +E+  +M DF+EP
Sbjct  1    MSWQTYVDDHLMCDIDG---HRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYLLEQG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 16. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 197.0 bits 768,  Expect = 1e-52
 Identities = 108/133 81%, Positives = 123/133 92%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMCDI+G +G+ LTAAAI+GHDGS+WAQS++FPQ+K +E+  I  DF EP
Sbjct  1    MSWQTYVDEHLMCDIDG-QGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGLHL GTKYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNM
Sbjct  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL++QGL
Sbjct  120  VVERLGDYLVDQGL 133

Sequence Alignment: 17. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 195.8 bits 763,  Expect = 3e-52
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDI+G   HRLTAAAI+GHDGSVWAQS++FPQFK +E+  IM DF+EP
Sbjct  1    MSWQTYVDDHLMCDIDG---HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLG TKYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYLLEQG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 18. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 195.0 bits 760,  Expect = 6e-52
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDIEG   + LT+AAI+G+DGSVWAQSA FPQFKPEE+  IM DF EP
Sbjct  1    MSWQTYVDDHLMCDIEG---NHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGEAGAVIRGKKG+GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDY++EQGL
Sbjct  118  IVERLGDYIIEQGL 131

Sequence Alignment: 19. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 195.0 bits 760,  Expect = 6e-52
 Identities = 111/131 84%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H LT+AAIVGHDG+VWAQSA FPQFKPEEM  IM DF+EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQGL
Sbjct  118  VVERLGDYLVEQGL 131

Sequence Alignment: 20. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 194.8 bits 759,  Expect = 7e-52
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVD+HLMC+I+G   H LTAAAI+GHDGSVWAQS++FPQFK EE+  IM DFNEP
Sbjct  1    MSWQAYVDEHLMCEIDG---HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNM
Sbjct  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLIEQGM 131

Sequence Alignment: 21. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 193.8 bits 755,  Expect = 1e-51
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H LT+AAIVGHDG+ WAQS  FP+FKPEEM  IM DF+EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+
Sbjct  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQG+
Sbjct  118  VVERLGDYLLEQGM 131

Sequence Alignment: 22. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 193.8 bits 755,  Expect = 1e-51
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+IEG   H LT+AAI+GHDG+VWAQSA FP FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCEIEG---HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            V+E+LGDYL+EQG+
Sbjct  118  VIEKLGDYLIEQGM 131

Sequence Alignment: 23. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 193.1 bits 752,  Expect = 2e-51
 Identities = 107/133 80%, Positives = 119/133 89%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDIEG   H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ +F+EP
Sbjct  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 24. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 192.8 bits 751,  Expect = 3e-51
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMC+IEG   +RLT+AAI+G+DGSVWAQSATFPQFKPEE+  IM DF EP
Sbjct  1    MSWQTYVDDHLMCEIEG---NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGEAGAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQ L
Sbjct  118  IVERLGDYLIEQSL 131

Sequence Alignment: 25. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 192.8 bits 751,  Expect = 3e-51
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDI+G   +RLTAAAI+G+DGSVW+QSATFP FKPEE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 26. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 192.8 bits 751,  Expect = 3e-51
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAY D+HLMC+IEG   +RL AAAI+GHDGSVWAQS+TFPQ+KPEE+ G+M DFNEP
Sbjct  1    MSWQAYGDEHLMCEIEG---NRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 27. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 192.6 bits 750,  Expect = 3e-51
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H L +AAI+GHDG+VWAQSA FPQFKPEE+ GIM DF+EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTG+ + G KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 28. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 192.6 bits 750,  Expect = 3e-51
 Identities = 108/132 81%, Positives = 119/132 90%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+IEG   H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
Query  121  VVERLGDYLLEQG 133
            +VERLGDYL+EQG
Sbjct  120  IVERLGDYLIEQG 132

Sequence Alignment: 29. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 191.8 bits 747,  Expect = 5e-51
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+IEG   + L+AAAI+GHDGSVWAQSATFPQ+KPEE+ GI+ DFNEP
Sbjct  1    MSWQAYVDDHLMCEIEG---NHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLVEQGL 131

Sequence Alignment: 30. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 191.3 bits 745,  Expect = 7e-51
 Identities = 108/131 82%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVD+HLMC+IEG   H L AAAIVGHDG+ WAQS  FP+FK E+M  IM DF+EP
Sbjct  1    MSWQAYVDEHLMCEIEG---HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQG+
Sbjct  118  VVERLGDYLLEQGM 131

Sequence Alignment: 31. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 191.3 bits 745,  Expect = 7e-51
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDI+G   +RLTAAAI+G+DGSVW+QSATFP FKPEE+  I+ DF++P
Sbjct  1    MSWQQYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 32. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 191.3 bits 745,  Expect = 7e-51
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDI+G   +RLTAAAI+G+DGSVW+QSATFP FKPEE+  I+ DF++P
Sbjct  1    MSWQQYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 191.1 bits 744,  Expect = 9e-51
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+IEG   + L+AAAI+GH+GSVWAQSATFPQ+KPEE+ GIM DFNEP
Sbjct  1    MSWQAYVDDHLMCEIEG---NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQGL
Sbjct  118  VVERLGDYLIEQGL 131

Sequence Alignment: 34. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 191.1 bits 744,  Expect = 9e-51
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDI+G   +RLTAAAI+G+DGSVW+QSATFP FKPEE+  I+ D+++P
Sbjct  1    MSWQAYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 190.9 bits 743,  Expect = 1e-50
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H L +AAI+GHDG+VWAQSA FPQFKPEE+ GIM DF+EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTG+ + G KYMVIQGE G VIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 36. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 190.9 bits 743,  Expect = 1e-50
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H L +AAI+GHDG+VWAQSA FPQFKPEE+ GIM DF+EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTG+ + G KYMVIQGE G VIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 37. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 190.6 bits 742,  Expect = 1e-50
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCD+EG   +RLTAAAI+G+DGSVWAQSA FPQ+KPEE+ GI  DF EP
Sbjct  1    MSWQTYVDDHLMCDVEG---NRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL +GGTKYMVIQGE  AVIRGKKG+GG+TIKKT QA+VFGIYEEP+TPGQCNM
Sbjct  58   GTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQGL
Sbjct  118  VVERLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 190.6 bits 742,  Expect = 1e-50
 Identities = 108/132 81%, Positives = 121/132 91%, Gaps = 2/132 1%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCD+ G +G+   +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDV-G-DGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEA 58
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGE+GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  59   GFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 118
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQGL
Sbjct  119  VVERLGDYLLEQGL 132

Sequence Alignment: 39. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 190.6 bits 742,  Expect = 1e-50
 Identities = 105/133 78%, Positives = 120/133 90%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMC+IEG   H LTAAAI+G DGSVWAQSA FPQFKP+E++ ++ +F+E 
Sbjct  1    MSWQTYVDDHLMCEIEGTNNH-LTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEA 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 40. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 190.4 bits 741,  Expect = 1e-50
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMC+ +G   + LTAAAI+GHDGSVWAQSA FPQFKP E+  IM DF+EP
Sbjct  1    MSWQTYVDDHLMCETDG---QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL++QGL
Sbjct  118  VVERLGDYLVDQGL 131

Sequence Alignment: 41. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 190.4 bits 741,  Expect = 1e-50
 Identities = 107/131 81%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H L++AAIVGHDG+VWAQS  FPQFKPEEM  I+ DF+EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAP GL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQGL
Sbjct  118  VVERLGDYLVEQGL 131

Sequence Alignment: 42. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 190.1 bits 740,  Expect = 2e-50
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDI+G   +RLTAAAI+G+DGSVW+QSA+FP FKPEE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQGL
Sbjct  118  VVERLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 188.9 bits 735,  Expect = 4e-50
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ Y D+HLMC+IEG   +RL AAAI+GHDGSVWAQS+TFPQ+KPEE+ G+M DFNEP
Sbjct  1    MSWQTYGDEHLMCEIEG---NRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GAVIR KKG GG+T+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 44. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 188.9 bits 735,  Expect = 4e-50
 Identities = 103/130 79%, Positives = 121/130 93%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+IEG   + L+AAAI+G+DGSVWAQSA FPQFK EE+ GIM+DF+EP
Sbjct  1    MSWQAYVDDHLMCEIEG---NHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL++GGTKYMVIQGE GAVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQG 133
            +VERLGDYL++QG
Sbjct  118  IVERLGDYLIDQG 130

Sequence Alignment: 45. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 188.9 bits 735,  Expect = 4e-50
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDIEG   + L++AAI+GHDG+VWAQS +FPQ+KPEE++ IM DFNEP
Sbjct  1    MSWQTYVDDHLMCDIEG---NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNM
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVER+GDYL+EQG+
Sbjct  118  VVERIGDYLVEQGM 131

Sequence Alignment: 46. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 188.9 bits 735,  Expect = 4e-50
 Identities = 103/133 77%, Positives = 119/133 89%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMC+IEG   H L+AAAI+G DGSVWAQSA+FPQFKP+E++ ++ DF+ P
Sbjct  1    MSWQTYVDDHLMCEIEGTNNH-LSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE G VIRGKKG GGI +KKTGQAL+ GIY+EPVTPGQCNM
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 47. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 188.4 bits 733,  Expect = 6e-50
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   H L +AAI GHDG+VWAQSA FPQFKPEE+ GIM D++EP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTG+ +   KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  58   GHLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 48. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 187.6 bits 730,  Expect = 9e-50
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHL+CDIEG   + LT AAI+G+DGSVWAQS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLLCDIEG---NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQG 133
            VVER GDYL++QG
Sbjct  118  VVERPGDYLIDQG 130

Sequence Alignment: 49. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 187.6 bits 730,  Expect = 9e-50
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+ LMC+IEG   + LTAAAI+G+DGSVWAQS+ FPQFK EE+  IM+DF+EP
Sbjct  1    MSWQTYVDERLMCEIEG---NHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGEAGAVIRGKKG GG+T++KT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYLLEQG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 50. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 187.6 bits 730,  Expect = 9e-50
 Identities = 104/133 78%, Positives = 120/133 90%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDIEG  G+ LT+AAI G DG+VWA+SA+FP+FKP E++ I+ +FNE 
Sbjct  1    MSWQTYVDDHLMCDIEG-TGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEA 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G+LAPTGL LGG KYMVIQGEAGAVIRGKKG+GGI IKKTGQA+VFGIY+EPV PGQCNM
Sbjct  60   GQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLL+QG+
Sbjct  120  VVERLGDYLLDQGM 133

Sequence Alignment: 51. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 187.4 bits 729,  Expect = 1e-49
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCD+ G +G+ L +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDV-G-DGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGE+GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQG+
Sbjct  118  VVERLGDYLLEQGM 131

Sequence Alignment: 52. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 187.2 bits 728,  Expect = 1e-49
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMCDI+G   +RLTAAAI+G+DGSVW+QSATFP F+ EE+  I+ DF++P
Sbjct  1    MSWQAYVDDHLMCDIDG---NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGEAGAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 187.2 bits 728,  Expect = 1e-49
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDIEG   + LT+AAI+GHDGSVWA SA+FPQF  EE++ IM DF EP
Sbjct  1    MSWQVYVDDHLMCDIEG---NTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+ G+Y+EP+TPGQCNM
Sbjct  58   GSLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 54. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 186.9 bits 727,  Expect = 2e-49
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSW+AYVDDHL C+I+G   + LT+AAI+GHDGSVWAQS  FPQFKPEE+ GI+ DF EP
Sbjct  1    MSWKAYVDDHLCCEIDG---QHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQG 133
            VVERLGDYL++QG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 55. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 186.9 bits 727,  Expect = 2e-49
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHL+CDIEG   + L+AAAIVGHDGSVWAQS  FP++KPEE+ G++ DF+EP
Sbjct  1    MSWQAYVDDHLLCDIEG---QHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL +GGTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLIEQGF 131

Sequence Alignment: 56. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 186.9 bits 727,  Expect = 2e-49
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHL+CDI+G+    LTAAAIVGHDGSVWAQS  FPQ KPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLLCDIDGQC---LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL++QG+
Sbjct  118  VVERLGDYLFDQGF 131

Sequence Alignment: 57. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 186.4 bits 725,  Expect = 2e-49
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+IEG   + LT+AAI+G+DGSVWA+S  FPQ+KPEE+ GI+ DFNEP
Sbjct  1    MSWQAYVDDHLMCEIEG---NHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL++GG+KYMVIQGE GAVIRGKKG GG+T+KKT  ALV GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 58. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 186.2 bits 724,  Expect = 3e-49
 Identities = 102/133 76%, Positives = 116/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            M WQ YVDDHLMC+IEG   H L+ AAI+G DGSVWAQSA+FPQFKP+E+  ++ DF+ P
Sbjct  1    MCWQTYVDDHLMCEIEGTNNH-LSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGLHLGGTKYMVIQGE G  IRGKKG GGI +KKTGQALVFGIY+EPVTPGQCNM
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 59. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 185.9 bits 723,  Expect = 3e-49
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHL+C IEG   + LT AAI+G+DGSVW QS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLLCGIEG---NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQG 133
            VVERLGDYL++QG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 60. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 185.9 bits 723,  Expect = 3e-49
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVD+HLMC+IEG   + L+AAAIVGHDGSVWAQS +FP++KPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDEHLMCEIEG---QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL +GGTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNM
Sbjct  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLIEQGF 131

Sequence Alignment: 61. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 185.9 bits 723,  Expect = 3e-49
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSW+AYVDDHL C+I+G+    LT+AAI+GHDGSVWAQS  FPQFKPEE  GI+ DF EP
Sbjct  1    MSWKAYVDDHLCCEIDGQN---LTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQG 133
            VVERLGDYL++QG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 62. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 185.7 bits 722,  Expect = 4e-49
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHL C+I+G   + LT+AAI+GHDGSVWA+S  FP+FKPEE+ GI+ DF EP
Sbjct  1    MSWQAYVDDHLCCEIDG---QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQG 133
            VVERLGDYL++QG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 63. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 184.9 bits 719,  Expect = 6e-49
 Identities = 102/133 76%, Positives = 118/133 88%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVD+HLMCDIEG  G+ LT+AAI+G DG+VWAQSA FPQFKPEEM GI+ +F+E 
Sbjct  1    MSWQAYVDEHLMCDIEG-TGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTG+ + G KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNM
Sbjct  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQG+
Sbjct  120  VVERLGDYLLEQGM 133

Sequence Alignment: 64. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 184.4 bits 717,  Expect = 9e-49
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHL C+I+G   + LT+AAI+GHDG VW QS  FPQFKPEE+ GI+ DF+EP
Sbjct  1    MSWQTYVDDHLCCEIDG---QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQG+
Sbjct  118  VVERLGDYLVEQGF 131

Sequence Alignment: 65. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 183.7 bits 714,  Expect = 1e-48
 Identities = 102/133 76%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMCDIEG  G+ LTAAAI+G DG+VWA+S  FP+FKPEEM GI+ +FNE 
Sbjct  1    MSWQTYVDDHLMCDIEG-TGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGG KYMV+QGEAGAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM
Sbjct  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++Q +
Sbjct  120  IVERLGDYLVDQNM 133

Sequence Alignment: 66. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 183.2 bits 712,  Expect = 2e-48
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHL C+I+G   + LT+AAI+GHDGSVW +S  FP+FKPEE+ GI+ DF EP
Sbjct  1    MSWQTYVDDHLCCEIDG---QHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQG 133
            VVERLGDYL++QG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 67. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 182.7 bits 710,  Expect = 3e-48
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMC+IEG   + LT+AAI+G+DGSVWAQS  FPQ+KPEE+ GI+ DF +P
Sbjct  1    MSWQVYVDEHLMCEIEG---NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL++GGTKYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++QGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 68. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 182.5 bits 709,  Expect = 3e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVDDHLMC+I+G   + L++AAI+GHD +VWAQS  FPQFKPEE++ I+ DF  P
Sbjct  1    MSWQAYVDDHLMCEIDG---QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYLLEQG+
Sbjct  118  VVERLGDYLLEQGF 131

Sequence Alignment: 69. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 181.5 bits 705,  Expect = 7e-48
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HL+C+   +EG+ LT+AAI+G+DG+VWAQSA FPQFKPEE+ GIM DF  P
Sbjct  1    MSWQTYVDEHLLCE---NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQ L
Sbjct  118  IVERLGDYLIEQSL 131

Sequence Alignment: 70. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 181.5 bits 705,  Expect = 7e-48
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HL+C+   +EG+ LT+AAI+G+DG+VWAQSA FPQFKPEE+ GIM DF  P
Sbjct  1    MSWQTYVDEHLLCE---NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL+EQ L
Sbjct  118  IVERLGDYLIEQSL 131

Sequence Alignment: 71. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 180.3 bits 700,  Expect = 2e-47
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ+YVDDHLMCD+EG   + LTAAAI+G+DGSVWAQSA FPQ+KP+E++GI  DF EP
Sbjct  1    MSWQSYVDDHLMCDVEG---NHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL LGG KYMVIQGE GAVIRGKKG GG+TIKKT QALVFG Y+EP+T GQCN+
Sbjct  58   GFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNL 117
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+E  L
Sbjct  118  VVERLGDYLIESEL 131

Sequence Alignment: 72. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 180.3 bits 700,  Expect = 2e-47
 Identities = 96/130 73%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HLMCD++G   H LT+AAI+GHDGSVWAQSA FP++KP E+  I+ DFNEP
Sbjct  1    MSWQTYVDEHLMCDMDG---HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTG+++ G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+
Sbjct  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
Query  121  VVERLGDYLLEQG 133
            VVERLGDYL+EQG
Sbjct  118  VVERLGDYLIEQG 130

Sequence Alignment: 73. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 175.3 bits 680,  Expect = 5e-46
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVD+HL+C+IEG     L++AAI+G+DG VWAQS+ FPQFKPEE+  IM DF EP
Sbjct  1    MSWQTYVDNHLLCEIEG---DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
            G LAPTGL+LGGTKYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
Query  121  VVERLGDYLLEQGL 134
            +VERLGDYL++ GL
Sbjct  118  IVERLGDYLIDTGL 131

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 174.6 bits 677,  Expect = 8e-46
 Identities = 98/133 73%, Positives = 113/133 84%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQAYVD+HLMC+IE   G+ LT++AIVG DGS+WAQS+ FPQ KP+E+  I  +F+ P
Sbjct  1    MSWQAYVDEHLMCNIED-TGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
              LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNM
Sbjct  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
Query  121  VVERLGDYLLEQGL 134
            VVERLGDYL+EQGL
Sbjct  120  VVERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 157.1 bits 606,  Expect = 1e-40
 Identities = 86/109 78%, Positives = 100/109 91%, Gaps = 3/109 2%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
            MSWQ YVDDHLMC+IEG+    LT+AAI+G+DGS+WAQSA+FPQFKPEE+  IM DF+EP
Sbjct  1    MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEP 57
Query  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEP 112
            G LAPTGL+LGGTKYMVIQGEAGAVIRGKKG GG+T+KKT QAL+ GIY+EP
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 135.6 bits 519,  Expect = 5e-34
 Identities = 106/130 81%, Positives = 117/130 90%, Gaps = 31/130 23%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQ---------------- 44
            MSWQ YVDDHLMCD+EG   H L +AAI+G DGSVWAQS  FP+                
Sbjct  1    MSWQTYVDDHLMCDLEG---HHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNC 57
Query  45   ------------FKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGS 92
                        FKPEE+  IM DF+EPG LAPTGL LGGTKYMVIQGE GAVIRGKKGS
Sbjct  58   YIMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGS 117
Query  93   GGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQG 133
             GITIKKTGQAL+FGIYEEPVTPGQCNMVVE++GDYL++QG
Sbjct  118  SGITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.8 bits 272,  Expect = 9e-16
 Identities = 53/122 43%, Positives = 76/122 62%, Gaps = 11/122 9%
Query  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVG-HDGSVWAQ-SATFP-QFKPEEMNGIMTDF 57
            MSWQ+YVD+++ C    H   RL  A I G +DG+VWA+    +P Q   +E+  I    
Sbjct  1    MSWQSYVDNQI-CQ---HVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAI 54
Query  58   -NEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPG 116
             + P  +   G+HLGG KY+ IQ +  +++RG+KGS  + I  T   L+     +   PG
Sbjct  55   RSNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPG 113
Query  117  QCNMVVERLGDYL 129
            Q N VVE+LGDYL
Sbjct  114  QLNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.