The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF
LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE
RLGDYLLEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9T0M8 Par j 3 131 888 217.1 1.2e-58
Q9XG85 Par j 3 132 855 209.3 2.7e-56
O49894 Mer a 1 133 739 181.9 4.9e-48
Q9AXH4 Cor a 2 131 733 180.5 1.3e-47
CAD37202 Pru p 4.0201 131 731 180.0 1.8e-47
AAL29690 Lyc e 1 131 730 179.8 2.1e-47
O24170 Ole e 2 134 729 179.6 2.5e-47
Q9XF41 Mal d 4 131 728 179.3 2.9e-47
Q9M7N0 Hev b 8.0201 131 726 178.9 4e-47
Q5XWE1 Citr l 2.0101 131 725 178.6 4.7e-47
O04725 Cyn d 12 131 725 178.6 4.7e-47
Q9FUD1 Ory s 12.0101 131 724 178.4 5.6e-47
O24650 Phl p 12.0102 131 724 178.4 5.6e-47
O24171 Ole e 2 134 724 178.4 5.8e-47
O24169 Ole e 2 134 720 177.4 1.1e-46
P35079 Phl p 12.0101 131 717 176.7 1.8e-46
CAA54686 Phl p 12.0101 131 717 176.7 1.8e-46
AAK01235 Cor a 2 131 717 176.7 1.8e-46
CAD10376 Cap a 2 131 716 176.5 2.1e-46
Q9M7M8 Hev b 8.0203 131 716 176.5 2.1e-46
Q9STB6 Hev b 8.0102 131 714 176.0 2.9e-46
O65809 Gly m 3 131 712 175.5 4e-46
Q9FR39 Zea m 12.0105 131 712 175.5 4e-46
CAD37201 Pru p 4.0101 131 711 175.3 4.7e-46
Q9XF37 Api g 4 134 711 175.3 4.9e-46
AAL92870 Che a 2 131 710 175.1 5.5e-46
QID21357 Pop n 2.0101 131 710 175.1 5.5e-46
ABU95412 Sin a 4.0101 131 710 175.1 5.5e-46
Q9LEI8 Hev b 8.0204 131 709 174.8 6.5e-46
P35083 Zea m 12.0103 131 709 174.8 6.5e-46
Q8L5D8 Pho d 2.0101 131 708 174.6 7.7e-46
FM164277 Tri a 12.0104 131 707 174.4 9.1e-46
O24282 Phl p 12.0103 131 707 174.4 9.1e-46
Q9XF42 Mal d 4 131 706 174.1 1.1e-45
O65810 Gly m 3 131 705 173.9 1.3e-45
AY081852 Pru du 4.0102 131 705 173.9 1.3e-45
AY081850 Pru du 4.0101 131 705 173.9 1.3e-45
Q9XF38 Pyr c 4 131 705 173.9 1.3e-45
Q9XF39 Pru av 4 131 704 173.7 1.5e-45
AAL76933 Dau c 4 134 704 173.6 1.5e-45
A0A2I4DNN6 Jug r 7.0101 131 703 173.4 1.7e-45
AAP13533 Cuc m 2 131 703 173.4 1.7e-45
P35081 Zea m 12.0101 131 702 173.2 2.1e-45
Q9M7M9 Hev b 8.0202 131 702 173.2 2.1e-45
P49234 Tri a 12.0103 140 702 173.1 2.2e-45
P49233 Tri a 12.0102 141 702 173.1 2.3e-45
O22655 Zea m 12.0104 131 700 172.7 2.8e-45
AAL07320 Lit c 1 131 700 172.7 2.8e-45
AAK54835 Ana c 1 131 698 172.2 4e-45
QVU02258 Que ac 2.0101 133 698 172.2 4e-45
AF377948 Mus a 1.0101 131 697 172.0 4.7e-45
Q9XF40 Mal d 4 131 697 172.0 4.7e-45
P52184 Hor v 12.0101 131 696 171.8 5.5e-45
P25816 Bet v 2 133 694 171.3 7.8e-45
P35082 Zea m 12.0102 131 693 171.1 9e-45
CAD10377 Lyc e 1 131 692 170.8 1.1e-44
O65812 Hev b 8.0101 131 692 170.8 1.1e-44
Q93YG7 Sola l 1.0101 131 692 170.8 1.1e-44
QRN65366 Lig v 2.0101 134 692 170.8 1.1e-44
P49232 Tri a 12.0101 138 692 170.8 1.1e-44
P84177 Cit s 2.0101 131 688 169.9 2e-44
Q5EF31 Cro s 1.0101 131 688 169.9 2e-44
Q42449 Ara t 8 131 684 168.9 3.9e-44
O81982 Hel a 2 133 682 168.5 5.5e-44
ACP43298 Ama r 2.0101 133 680 168.0 7.7e-44
AJ421030 Art v 4.0101 133 678 167.5 1.1e-43
XP030492464 Can s 2.0101 133 678 167.5 1.1e-43
ACS34771 Sal k 4.0101 133 676 167.0 1.5e-43
A0A0A0REA1 Koc s 2.0101 133 676 167.0 1.5e-43
Q9SQI9 Ara h 5 131 674 166.6 2e-43
A0A023W2L7 Pro j 2.0101 133 669 165.4 4.7e-43
AJ421031 Art v 4.0201 133 669 165.4 4.7e-43
A0A0A0RCW1 Aca f 2 133 649 160.7 1.2e-41
ADK22841 Sal k 4.0201 133 646 159.9 2e-41
FG438715 Act d 9.0101 109 584 145.4 3.9e-37
QEQ43417 Sola m 1.0101 159 475 119.5 3.7e-29
A0A1B2YLJ4 Tyr p 36.0101 131 244 65.0 7.7e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 217.1 bits 888,  Expect = 1e-58
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  61   LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE 120
            LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 2. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 209.3 bits 855,  Expect = 3e-56
 Identities = 128/131 97%, Positives = 129/131 98%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCDVGDGNT ASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGESGAVI GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 3. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 181.9 bits 739,  Expect = 5e-48
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVDDHLMCD+ G G  LA+A+I+GHDGS+WAQSA+FPQLKPEE+TGIM DF+E G
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL++ GTKYMVIQGESGAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 4. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 180.5 bits 733,  Expect = 1e-47
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAY D+HLMC++ +GN LA+AAIIGHDGSVWAQS+ FPQLKPEE+TG+MNDFNE G 
Sbjct  1    MSWQAYGDEHLMCEI-EGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 5. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 180.0 bits 731,  Expect = 2e-47
 Identities = 106/130 81%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMC++ +GN L++AAIIGHDGSVWAQSA FPQLKPEEVTGI+NDFNE G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKG GG T+KK+  A++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 179.8 bits 730,  Expect = 2e-47
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ +GN L SAAIIG+DGSVWAQSANFPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQTYVDDHLMCDI-EGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE+GAVI GKKG+GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDY++EQG+
Sbjct  120  ERLGDYIIEQGL 131

Sequence Alignment: 7. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 179.6 bits 729,  Expect = 3e-47
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDV-G-DGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
            MSWQAYVDDHLMCD+ G +G+ L +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE+GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VVERLGDYLLEQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 8. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 179.3 bits 728,  Expect = 3e-47
 Identities = 106/130 81%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMC++ +GN L++AAIIGH+GSVWAQSA FPQLKPEEVTGIMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE G VI GKKG GG T+KK+  A++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 9. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 178.9 bits 726,  Expect = 4e-47
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMCD+ DG+ L +AAIIGHDGSVWAQS++FPQ+KPEEV  IM DF+E G 
Sbjct  1    MSWQTYVDEHLMCDI-DGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 10. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 178.6 bits 725,  Expect = 5e-47
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMC++ +GN L SAAIIG+DGSVWA+S NFPQLKPEE+TGI+NDFNE G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL++GG+KYMVIQGE GAVI GKKG GG T+KKT  A+VIGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 11. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 178.6 bits 725,  Expect = 5e-47
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMC++ +G+ L SAAIIGHDG+VWAQSA FP +KPEE+  IM DF+E GF
Sbjct  1    MSWQAYVDDHLMCEI-EGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+V+
Sbjct  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVI 119
Query  120  ERLGDYLLEQGM 131
            E+LGDYL+EQGM
Sbjct  120  EKLGDYLIEQGM 131

Sequence Alignment: 12. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 178.4 bits 724,  Expect = 6e-47
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ L SAAI+GHDG+VWAQSA FPQ+KPEE+T IM DF+E GF
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 13. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 178.4 bits 724,  Expect = 6e-47
 Identities = 102/130 78%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ LASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTG+F+ G KYMVIQGE GAVI GKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 14. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 178.4 bits 724,  Expect = 6e-47
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDV-G-DGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
            MSWQAYVDDHLMCD+ G +G+ L +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE+GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            V ERLGDYLLEQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 15. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 177.4 bits 720,  Expect = 1e-46
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDV-G-DGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
            MSWQAYVDDHLMCD+ G + + L +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE+GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VVERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 16. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 176.7 bits 717,  Expect = 2e-46
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ LASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTG+F+ G KYMVIQGE G VI GKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 17. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 176.7 bits 717,  Expect = 2e-46
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ LASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTG+F+ G KYMVIQGE G VI GKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 18. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 176.7 bits 717,  Expect = 2e-46
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ Y D+HLMC++ +GN LA+AAIIGHDGSVWAQS+ FPQLKPEE+TG+MNDFNE G 
Sbjct  1    MSWQTYGDEHLMCEI-EGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIG-KKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GAVI  KKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 19. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 176.5 bits 716,  Expect = 2e-46
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMC++ +GN L SAAIIG+DGSVWAQSA FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQTYVDDHLMCEI-EGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE+GAVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQ +
Sbjct  120  ERLGDYLIEQSL 131

Sequence Alignment: 20. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 176.5 bits 716,  Expect = 2e-46
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ DG+ L +AAIIGHDGSVWAQS+ FPQ+K +EV  +M DF+E G 
Sbjct  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 21. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 176.0 bits 714,  Expect = 3e-46
 Identities = 102/129 79%, Positives = 121/129 93%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMC++ +GN L++AAIIG+DGSVWAQSANFPQ+K EE+TGIM+DF+E G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL++GGTKYMVIQGE GAVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 175.5 bits 712,  Expect = 4e-46
 Identities = 103/129 79%, Positives = 117/129 90%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHL+CD+ +GN L  AAIIG+DGSVWAQS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLLCDI-EGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQG 130
            ER GDYL++QG
Sbjct  120  ERPGDYLIDQG 130

Sequence Alignment: 23. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 175.5 bits 712,  Expect = 4e-46
 Identities = 100/129 77%, Positives = 118/129 91%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHL+CD+ +G  L++AAI+GHDGSVWAQS NFP+LKPEEV G++ DF+E G 
Sbjct  1    MSWQAYVDDHLLCDI-EGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLF+GGTKYMVIQGE G VI GKKG+GG T+KKTG +++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLIEQG 130

Sequence Alignment: 24. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 175.3 bits 711,  Expect = 5e-46
 Identities = 100/130 76%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE+GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 25. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 175.3 bits 711,  Expect = 5e-46
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDV-GD-GNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
            MSWQAYVDDHLMC+V G+ G TL +AAIIGHDGSVWAQS+ FPQ+KPEE+ GIM DF+E 
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
            G LAPTGL+LGG KYMVIQGE  AVI GKKGSGG T+KKTGQA+V G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLLEQGM 131
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 26. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 175.1 bits 710,  Expect = 6e-46
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ +GN L+SAAI+GHDG+VWAQS +FPQLKPEEV+ IM DFNE G 
Sbjct  1    MSWQTYVDDHLMCDI-EGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE G VI GKKG GG T+KKT QA++IGIY EPMTPGQCN+VV
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ER+GDYL+EQGM
Sbjct  120  ERIGDYLVEQGM 131

Sequence Alignment: 27. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 175.1 bits 710,  Expect = 6e-46
 Identities = 102/130 78%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ +GNTL SAAIIGHDGSVWA SA+FPQ+  EEV+ IM DF E G 
Sbjct  1    MSWQVYVDDHLMCDI-EGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE GAVI GKKGSGG T+KKT QA++IG+YDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 28. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 175.1 bits 710,  Expect = 6e-46
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCDV +GN L +AAI+G+DGSVWAQSANFPQLKPEE+ GI NDF E G 
Sbjct  1    MSWQTYVDDHLMCDV-EGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLF+GGTKYMVIQGE  AVI GKKG+GG T+KKT QA V GIY+EPMTPGQCN+VV
Sbjct  60   LAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 29. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 174.8 bits 709,  Expect = 7e-46
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ DG+ L +AAIIGHDGSVWAQS++FPQ+K +EV  +M DF+E G 
Sbjct  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLL+QG+
Sbjct  120  ERLGDYLLDQGL 131

Sequence Alignment: 30. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 174.8 bits 709,  Expect = 7e-46
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ L+SAAI+GHDG+VWAQS  FPQ+KPEE+T I+ DF+E GF
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAP GLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+VV
Sbjct  60   LAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 31. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 174.6 bits 708,  Expect = 8e-46
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVD+HLMC++ DG+ L +AAI+GHDGSVWAQS++FPQ+K EE+T IMNDFNE G 
Sbjct  1    MSWQAYVDEHLMCEI-DGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LG TKYMVIQGE GAVI GKKGSGG T+KKT QA++ GIY+EPMTPGQCN+VV
Sbjct  60   LAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLIEQGM 131

Sequence Alignment: 32. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 174.4 bits 707,  Expect = 9e-46
 Identities = 101/129 78%, Positives = 115/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSW+AYVDDHL C++ DG  L SAAI+GHDGSVWAQS NFPQ+KPEE+ GI+ DF E G 
Sbjct  1    MSWKAYVDDHLCCEI-DGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 174.4 bits 707,  Expect = 9e-46
 Identities = 100/130 76%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ LASAAI GHDG+VWAQSA+FPQ+KPEE+TGIM D++E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTG+F+   KYMVIQGE GAVI GKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 34. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 174.1 bits 706,  Expect = 1e-45
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA+FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN+VV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 173.9 bits 705,  Expect = 1e-45
 Identities = 102/129 79%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHL+C + +GN L  AAIIG+DGSVW QS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLLCGI-EGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 36. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 173.9 bits 705,  Expect = 1e-45
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQQYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE+GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 173.9 bits 705,  Expect = 1e-45
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQQYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE+GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 173.9 bits 705,  Expect = 1e-45
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCD+ DG+ L +AAI+GHDGSVWAQS+ FP++KPEE+T IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDI-DGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKT QA+V GIY+EP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 39. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 173.7 bits 704,  Expect = 1e-45
 Identities = 99/130 76%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA FP +KPEE+  I+ D+++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE+GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 40. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 173.6 bits 704,  Expect = 2e-45
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 5/130 3%
Query  1    MSWQAYVDDHLMCDVGDGNT---LASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE 57
            MSWQ YVDDHLMC+V DGN    L++AAIIGHDGSVWAQS+ FP++KPEE+TGIM +F+E
Sbjct  1    MSWQTYVDDHLMCEV-DGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDE 59
Query  58   GGFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCN 116
             G LAPTGL+LGGTKYMVIQGE  AVI GKKGSGG T+KKTGQA+V G+YDEP+TPGQCN
Sbjct  60   PGHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCN 119
Query  117  LVVERLGDYLLEQGM 131
            L+VERLGDYL+EQG+
Sbjct  120  LIVERLGDYLIEQGL 134

Sequence Alignment: 41. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 173.4 bits 703,  Expect = 2e-45
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ DG  L +AAIIGHDGSVWAQS++FPQ+KPEE+  IM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-DGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE+GAVI GKKG+GG T+KKTGQA++ GIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 42. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 173.4 bits 703,  Expect = 2e-45
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +GN L SAAIIG+DGSVWAQS NFPQLKPEEV GI+ DF + G 
Sbjct  1    MSWQVYVDEHLMCEI-EGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL++GGTKYMVIQGE GAVI GKKG GG T+KKTG A+VIGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 43. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 173.2 bits 702,  Expect = 2e-45
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMC++ +G+ L SAAI+GHDG+ WAQS  FP++KPEE+  IM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQ+++IGIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 44. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 173.2 bits 702,  Expect = 2e-45
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMCD+ DG+ L +AAIIGHDGSVWAQS++FPQ+K +EV  IM DF+E G 
Sbjct  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LG TKYMVIQGE GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 45. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 173.1 bits 702,  Expect = 2e-45
 Identities = 101/129 78%, Positives = 114/129 88%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSW+AYVDDHL C++ DG  L SAAI+GHDGSVWAQS NFPQ+KPEE  GI+ DF E G 
Sbjct  1    MSWKAYVDDHLCCEI-DGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 46. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 173.1 bits 702,  Expect = 2e-45
 Identities = 100/129 77%, Positives = 115/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHL C++ DG  L SAAI+GHDGSVWA+S NFP++KPEE+ GI+ DF E G 
Sbjct  1    MSWQAYVDDHLCCEI-DGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 47. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 172.7 bits 700,  Expect = 3e-45
 Identities = 98/129 75%, Positives = 118/129 91%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVD+HLMC++ +G  L++AAI+GHDGSVWAQS +FP+LKPEEV GI+ DF+E G 
Sbjct  1    MSWQAYVDEHLMCEI-EGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLF+GGTKYMVIQGE G VI GKKG+GG T+KKTG +++IG+YDEPMTPGQCN+VV
Sbjct  60   LAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLIEQG 130

Sequence Alignment: 48. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 172.7 bits 700,  Expect = 3e-45
 Identities = 102/130 78%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMC+  DG  L +AAIIGHDGSVWAQSANFPQ+KP E+  IM DF+E G 
Sbjct  1    MSWQTYVDDHLMCET-DGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLVDQGL 131

Sequence Alignment: 49. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 172.2 bits 698,  Expect = 4e-45
 Identities = 99/129 76%, Positives = 115/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMC++ DG  L+SAAI+GHD +VWAQS NFPQ+KPEE++ I+NDF   G 
Sbjct  1    MSWQAYVDDHLMCEI-DGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE G VI GKKG+GG T+KKT  A++IG+YDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYLLEQG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 50. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 172.2 bits 698,  Expect = 4e-45
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVD+HLMCD+ G G  LA+AAIIGHDGSVWAQS+NFPQ+K EE++ IM DF E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE+GAVI GKKGSGG T+KKT QA+V GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 51. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 172.0 bits 697,  Expect = 5e-45
 Identities = 100/129 77%, Positives = 114/129 88%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHL+CD+ DG  L +AAI+GHDGSVWAQS  FPQ KPEE+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLLCDI-DGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKGSGG T+KKT  A++IGIY+EPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLFDQG 130

Sequence Alignment: 52. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 172.0 bits 697,  Expect = 5e-45
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDD LMCD+ DG+ L +AAI+GHDGSVWA+S+ FP++KPEE+T IM DF+E G 
Sbjct  1    MSWQAYVDDRLMCDI-DGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 53. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 171.8 bits 696,  Expect = 5e-45
 Identities = 99/129 76%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHL C++ DG  L SAAI+GHDG VW QS NFPQ+KPEE+ GI+ DF+E G 
Sbjct  1    MSWQTYVDDHLCCEI-DGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG  +++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLVEQG 130

Sequence Alignment: 54. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 171.3 bits 694,  Expect = 8e-45
 Identities = 102/129 79%, Positives = 120/129 93%, Gaps = 6/129 4%
Query  1    MSWQAYVDDHLMCDVGDG---NTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE 57
            MSWQ YVD+HLMCD+ DG   N+LASA I+GHDGSVWAQS++FPQ+KP+E+TGIM DF E
Sbjct  1    MSWQTYVDEHLMCDI-DGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEE 58
Query  58   GGFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCN 116
             G LAPTGL LGG KYMVIQGE+GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN
Sbjct  59   PGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCN 118
Query  117  LVVERLGDYLLEQGM 131
            +VVERLGDYL++QG+
Sbjct  119  MVVERLGDYLIDQGL 133

Sequence Alignment: 55. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 171.1 bits 693,  Expect = 9e-45
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVD+HLMC++ +G+ LA+AAI+GHDG+ WAQS  FP++K E++  IM DF+E G 
Sbjct  1    MSWQAYVDEHLMCEI-EGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 56. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 170.8 bits 692,  Expect = 1e-44
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HL+C+  +GN L SAAIIG+DG+VWAQSANFPQ+KPEE+TGIMNDF   G 
Sbjct  1    MSWQTYVDEHLLCE-NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE  AVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQ +
Sbjct  120  ERLGDYLIEQSL 131

Sequence Alignment: 57. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 170.8 bits 692,  Expect = 1e-44
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+ LMC++ +GN L +AAIIG+DGSVWAQS+NFPQ+K EE+T IM+DF+E G 
Sbjct  1    MSWQTYVDERLMCEI-EGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE+GAVI GKKG GG T++KT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 58. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 170.8 bits 692,  Expect = 1e-44
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HL+C+  +GN L SAAIIG+DG+VWAQSANFPQ+KPEE+TGIMNDF   G 
Sbjct  1    MSWQTYVDEHLLCE-NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE  AVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQ +
Sbjct  120  ERLGDYLIEQSL 131

Sequence Alignment: 59. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 170.8 bits 692,  Expect = 1e-44
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCDV-G-DGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
            MSWQAYVDDHLMCD+ G + + L +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE+GAVI GKKGSGG T+KKT QA+V GIY+EP+TPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VV RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 60. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 170.8 bits 692,  Expect = 1e-44
 Identities = 98/129 75%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHL C++ DG  L SAAI+GHDGSVW +S NFP++KPEE+ GI+ DF E G 
Sbjct  1    MSWQTYVDDHLCCEI-DGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 61. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 169.9 bits 688,  Expect = 2e-44
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQAYVDDHLMCD+ DGN L +AAI+G+DGSVW+QSA FP ++ EE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE+GAVI GKKGSGG  +KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 62. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 169.9 bits 688,  Expect = 2e-44
 Identities = 97/129 75%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HLMCD+ DG+ L SAAI+GHDGSVWAQSA FP+LKP E+T I+NDFNE G 
Sbjct  1    MSWQTYVDEHLMCDM-DGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTG+++ G KYMVIQGE G VI GKKGSGG T+KK+  A++ G+YDEPMTPGQCNLVV
Sbjct  60   LAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLIEQG 130

Sequence Alignment: 63. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 168.9 bits 684,  Expect = 4e-44
 Identities = 101/127 79%, Positives = 111/127 87%, Gaps = 2/127 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ+YVDDHLMCDV +GN L +AAI+G+DGSVWAQSA FPQLKP+E+ GI  DF E GF
Sbjct  1    MSWQSYVDDHLMCDV-EGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGLFLGG KYMVIQGE GAVI GKKG GG T+KKT QA+V G YDEPMT GQCNLVV
Sbjct  60   LAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVV 119
Query  120  ERLGDYLLE 128
            ERLGDYL+E
Sbjct  120  ERLGDYLIE 128

Sequence Alignment: 64. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 168.5 bits 682,  Expect = 6e-44
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQAYVD+HLMCD+ G G  L SAAI+G DG+VWAQSA FPQ+KPEE+ GI+ +F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTG+F+ G KYMV+QGE GAVI GKKG+GG  +KKTGQA+++GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLLEQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 65. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 168.0 bits 680,  Expect = 8e-44
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQAYVDDHLMC++ G  N L  AAI+G DGSVWAQSA+FPQ+KP+E+  I+ DF+E G
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE GAVI GKKG+GG  +KKTGQA+V+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 66. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 167.5 bits 678,  Expect = 1e-43
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVDDHLMCD+ G G  L SAAI G DG+VWA+SA+FP++KP E+  I+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMVIQGE+GAVI GKKG+GG  +KKTGQA+V GIYDEP+ PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLL+QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 67. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 167.5 bits 678,  Expect = 1e-43
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVD+HLMCD+ G G  L +AAIIGHDGS+WAQS++FPQLK +E+T I  DF E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL L GTKYMVIQGE GAVI GKKGSGG T+KKTGQA++ GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 68. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 167.0 bits 676,  Expect = 1e-43
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVDDHLMC++ G  N L +AAI+G DGSVWAQSANFPQ+KP+E++ ++ +F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE+G VI GKKG GG  +KKTGQA++ GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 69. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 167.0 bits 676,  Expect = 1e-43
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVDDHLMCD+ G  N L  AAI+G DGSVWAQSANFPQ+KP+E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE+G VI GKKG GG  +KKTGQA++ GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 70. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 166.6 bits 674,  Expect = 2e-43
 Identities = 93/130 71%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVD+HL+C++ +G+ L+SAAI+G+DG VWAQS++FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQTYVDNHLLCEI-EGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
            LAPTGL+LGGTKYMVIQGE GA+I GKKG GG T++KT QA++IGIYD+PMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYL++ G+
Sbjct  120  ERLGDYLIDTGL 131

Sequence Alignment: 71. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 165.4 bits 669,  Expect = 5e-43
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVDDHLMC++ G  N L++AAI+G DGSVWAQSA+FPQ+KP+E++ ++ DF+  G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VI GKKG GG  +KKTGQA++IGIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 72. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 165.4 bits 669,  Expect = 5e-43
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQ YVDDHLMCD+ G G  L +AAI+G DG+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMV+QGE+GAVI GKKG+GG  +KKTGQA+V+GIYDEP+ PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 73. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 160.7 bits 649,  Expect = 1e-41
 Identities = 93/131 70%, Positives = 110/131 83%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            M WQ YVDDHLMC++ G  N L+ AAI+G DGSVWAQSA+FPQ+KP+E+  ++ DF+  G
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G  I GKKG GG  +KKTGQA+V GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 159.9 bits 646,  Expect = 2e-41
 Identities = 92/131 70%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCDVGD-GNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
            MSWQAYVD+HLMC++ D GN L S+AI+G DGS+WAQS+NFPQ+KP+E+  I  +F+   
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMVIQGE GAVI GKKG GG  +KKT QA++ GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 145.4 bits 584,  Expect = 4e-37
 Identities = 85/108 78%, Positives = 99/108 91%, Gaps = 2/108 1%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
            MSWQ YVDDHLMC++ +GN L SAAIIG+DGS+WAQSA+FPQ+KPEE+T IMNDF+E G 
Sbjct  1    MSWQTYVDDHLMCEI-EGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEP 109
            LAPTGL+LGGTKYMVIQGE+GAVI GKKG GG T+KKT QA++IGIYDEP
Sbjct  60   LAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 119.5 bits 475,  Expect = 4e-29
 Identities = 99/129 76%, Positives = 117/129 90%, Gaps = 30/129 23%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQ------------------ 42
            MSWQ YVDDHLMCD+ +G+ LASAAI+G DGSVWAQS  FP+                  
Sbjct  1    MSWQTYVDDHLMCDL-EGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYI 59
Query  43   ----------LKPEEVTGIMNDFNEGGFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGG 91
                      +KPEE+T IM DF+E GFLAPTGLFLGGTKYMVIQGE GAVI GKKGS G
Sbjct  60   MRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSG 119
Query  92   ATLKKTGQAIVIGIYDEPMTPGQCNLVVERLGDYLLEQG 130
             T+KKTGQA++ GIY+EP+TPGQCN+VVE++GDYL++QG
Sbjct  120  ITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 65.0 bits 244,  Expect = 8e-13
 Identities = 50/121 41%, Positives = 73/121 60%, Gaps = 10/121 8%
Query  1    MSWQAYVDDHLMCDVGDGNTLASAAIIG-HDGSVWAQ-SANFP-QLKPEEVTGIMNDF-- 55
            MSWQ+YVD+++ C   D      A I G +DG+VWA+   ++P Q+  +E+  I +    
Sbjct  1    MSWQSYVDNQI-CQHVDCRL---AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRS 56
Query  56   NEGGFLAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQC 115
            N   FL   G+ LGG KY+ IQ ++  V G+KGS    +  T   ++     +   PGQ 
Sbjct  57   NPNSFLEG-GIHLGGEKYICIQADNSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQL 115
Query  116  NLVVERLGDYL 126
            N VVE+LGDYL
Sbjct  116  NNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.