The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL
APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE
RLGDYLLEQGF
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK54835 Ana c 1 131 894 226.5 1.8e-61
FM164277 Tri a 12.0104 131 803 204.2 9.5e-55
P49233 Tri a 12.0102 141 798 202.9 2.5e-54
P52184 Hor v 12.0101 131 793 201.7 5.2e-54
P49232 Tri a 12.0101 138 788 200.5 1.3e-53
P49234 Tri a 12.0103 140 786 200.0 1.9e-53
CAD37202 Pru p 4.0201 131 781 198.8 4e-53
Q9FR39 Zea m 12.0105 131 778 198.0 6.7e-53
O22655 Zea m 12.0104 131 778 198.0 6.7e-53
Q9XF41 Mal d 4 131 778 198.0 6.7e-53
AAL07320 Lit c 1 131 776 197.6 9.5e-53
AF377948 Mus a 1.0101 131 776 197.6 9.5e-53
AAL92870 Che a 2 131 776 197.6 9.5e-53
Q5XWE1 Citr l 2.0101 131 772 196.6 1.9e-52
Q9M7N0 Hev b 8.0201 131 771 196.3 2.2e-52
Q8L5D8 Pho d 2.0101 131 768 195.6 3.7e-52
Q9STB6 Hev b 8.0102 131 768 195.6 3.7e-52
AAL29690 Lyc e 1 131 767 195.3 4.4e-52
O65809 Gly m 3 131 763 194.4 8.7e-52
A0A2I4DNN6 Jug r 7.0101 131 761 193.9 1.2e-51
O65810 Gly m 3 131 760 193.6 1.4e-51
CAD10376 Cap a 2 131 754 192.2 4e-51
AAP13533 Cuc m 2 131 752 191.7 5.6e-51
Q9XF38 Pyr c 4 131 751 191.4 6.7e-51
Q9FUD1 Ory s 12.0101 131 750 191.2 7.9e-51
Q9M7M8 Hev b 8.0203 131 750 191.2 7.9e-51
O24650 Phl p 12.0102 131 749 190.9 9.4e-51
O04725 Cyn d 12 131 748 190.7 1.1e-50
Q9LEI8 Hev b 8.0204 131 748 190.7 1.1e-50
CAD37201 Pru p 4.0101 131 748 190.7 1.1e-50
Q9AXH4 Cor a 2 131 747 190.4 1.3e-50
CAD10377 Lyc e 1 131 747 190.4 1.3e-50
Q93YG7 Sola l 1.0101 131 747 190.4 1.3e-50
QID21357 Pop n 2.0101 131 746 190.2 1.6e-50
CAA54686 Phl p 12.0101 131 746 190.2 1.6e-50
P35079 Phl p 12.0101 131 746 190.2 1.6e-50
Q9M7M9 Hev b 8.0202 131 745 189.9 1.9e-50
Q5EF31 Cro s 1.0101 131 744 189.7 2.2e-50
Q9SQI9 Ara h 5 131 744 189.7 2.2e-50
P35081 Zea m 12.0101 131 744 189.7 2.2e-50
Q9XF42 Mal d 4 131 744 189.7 2.2e-50
AY081852 Pru du 4.0102 131 742 189.2 3.1e-50
AY081850 Pru du 4.0101 131 742 189.2 3.1e-50
P35083 Zea m 12.0103 131 742 189.2 3.1e-50
Q9XF39 Pru av 4 131 741 189.0 3.7e-50
O65812 Hev b 8.0101 131 737 188.0 7.3e-50
Q9XF40 Mal d 4 131 734 187.2 1.2e-49
ACP43298 Ama r 2.0101 133 734 187.2 1.2e-49
AAK01235 Cor a 2 131 731 186.5 2e-49
O24282 Phl p 12.0103 131 730 186.3 2.4e-49
A0A023W2L7 Pro j 2.0101 133 729 186.0 2.9e-49
P84177 Cit s 2.0101 131 725 185.0 5.6e-49
P35082 Zea m 12.0102 131 724 184.8 6.6e-49
AAL76933 Dau c 4 134 722 184.3 9.7e-49
QVU02258 Que ac 2.0101 133 721 184.0 1.1e-48
ABU95412 Sin a 4.0101 131 715 182.6 3.1e-48
O49894 Mer a 1 133 713 182.1 4.4e-48
Q9XG85 Par j 3 132 710 181.3 7.3e-48
Q9XF37 Api g 4 134 710 181.3 7.5e-48
O24170 Ole e 2 134 709 181.1 8.8e-48
A0A0A0RCW1 Aca f 2 133 706 180.3 1.5e-47
O24171 Ole e 2 134 704 179.8 2.1e-47
O24169 Ole e 2 134 704 179.8 2.1e-47
A0A0A0REA1 Koc s 2.0101 133 702 179.4 2.9e-47
XP030492464 Can s 2.0101 133 700 178.9 4e-47
ACS34771 Sal k 4.0101 133 699 178.6 4.8e-47
Q9T0M8 Par j 3 131 698 178.4 5.6e-47
P25816 Bet v 2 133 695 177.6 9.5e-47
QRN65366 Lig v 2.0101 134 695 177.6 9.6e-47
O81982 Hel a 2 133 690 176.4 2.2e-46
Q42449 Ara t 8 131 684 175.0 6e-46
ADK22841 Sal k 4.0201 133 677 173.2 2e-45
AJ421030 Art v 4.0101 133 675 172.7 2.9e-45
AJ421031 Art v 4.0201 133 664 170.0 1.9e-44
FG438715 Act d 9.0101 109 619 159.1 2.9e-41
QEQ43417 Sola m 1.0101 159 490 127.1 1.8e-31
A0A1B2YLJ4 Tyr p 36.0101 131 276 74.7 9e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 226.5 bits 894,  Expect = 2e-61
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYLLEQGF
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 2. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 204.2 bits 803,  Expect = 1e-54
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSW+AYVDDHL CEIDGQHL+SAAILGHD +VWAQSPNFPQFKPEEI+ I+ DFE PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT +ALI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 3. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 202.9 bits 798,  Expect = 3e-54
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHL CEIDGQHL+SAAILGHD +VWA+SPNFP+FKPEEI+ I+ DFE PG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT +ALI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 4. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 201.7 bits 793,  Expect = 5e-54
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHL CEIDGQHL+SAAILGHD  VW QSPNFPQFKPEEI+ I+ DF+ PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT + LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 5. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 200.5 bits 788,  Expect = 1e-53
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHL CEIDGQHL+SAAILGHD +VW +SPNFP+FKPEEI+ I+ DFE PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT +ALI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 6. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 200.0 bits 786,  Expect = 2e-53
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSW+AYVDDHL CEIDGQ+L+SAAILGHD +VWAQSPNFPQFKPEE + I+ DFE PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT +ALI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 7. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 198.8 bits 781,  Expect = 4e-53
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMCEI+G HLS+AAI+GHD +VWAQS  FPQ+KPEE++ ILNDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GG+TVKK+ LAL+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 8. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 198.0 bits 778,  Expect = 7e-53
 Identities = 104/131 79%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHL+C+I+GQHLS+AAI+GHD +VWAQS NFP++KPEE++ ++ DF+ PG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGVVIRGKKGTGGIT+KKT ++LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 9. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 198.0 bits 778,  Expect = 7e-53
 Identities = 106/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVD+HLMCEI+GQHLS+AAI+GHD +VWAQS +FP++KPEE++ I+ DF+ PG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGVVIRGKKGTGGIT+KKT ++LIIGVYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 10. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 198.0 bits 778,  Expect = 7e-53
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMCEI+G HLS+AAI+GH+ +VWAQS  FPQ+KPEE++ I+NDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGVVIRGKKG GG+TVKK+ +AL+IG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 11. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 197.6 bits 776,  Expect = 9e-53
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMCE DGQHL++AAI+GHD +VWAQS NFPQFKP EI+AI+ DF+ PGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GGITVKKT  ALIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 12. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 197.6 bits 776,  Expect = 9e-53
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHL+C+IDGQ L++AAI+GHD +VWAQS  FPQ KPEEI+AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG+GG+T+KKTNLALIIG+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QGF
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 13. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 197.6 bits 776,  Expect = 9e-53
 Identities = 108/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+I+G HLSSAAILGHD TVWAQSP+FPQ+KPEE+SAI+ DF  PGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTN ALIIG+Y EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            R+GDYL+EQG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 14. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 196.6 bits 772,  Expect = 2e-52
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMCEI+G HL+SAAI+G+D +VWA+S NFPQ+KPEEI+ ILNDF  PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLY+GG+KYMVIQGEPG VIRGKKG GG+TVKKT LAL+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 15. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 196.3 bits 771,  Expect = 2e-52
 Identities = 105/130 80%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMC+IDG+HL++AAI+GHD +VWAQS +FPQFKPEE++AI+ DF+ PGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GGITVKKT  ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 16. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 195.6 bits 768,  Expect = 4e-52
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVD+HLMCEIDG+HL++AAILGHD +VWAQS +FPQFK EEI+ I+NDF  PGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPG VIRGKKG+GG+TVKKTN ALI G+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 17. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 195.6 bits 768,  Expect = 4e-52
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMCEI+G HLS+AAI+G+D +VWAQS NFPQFK EEI+ I++DF  PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPG VIRGKKG GG+TVKKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 18. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 195.3 bits 767,  Expect = 4e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+I+G HL+SAAI+G+D +VWAQS NFPQFKPEEI+AI+NDF  PG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGITVKKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 19. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 194.4 bits 763,  Expect = 9e-52
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHL+C+I+G HL+ AAI+G+D +VWAQS +FPQFKPEEI+AI+NDF  PGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GG+TVKKT  ALIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            R GDYL++QG+
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 20. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 193.9 bits 761,  Expect = 1e-51
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEIDGQHL++AAI+GHD +VWAQS +FPQFKPEEI+AI+ DF+ PGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGITVKKT  ALI G+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 21. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 193.6 bits 760,  Expect = 1e-51
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHL+C I+G HL+ AAI+G+D +VW QS +FPQFKPEEI+AI+NDF  PGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GG+TVKKT  ALIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 22. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 192.2 bits 754,  Expect = 4e-51
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMCEI+G  L+SAAI+G+D +VWAQS  FPQFKPEEI+AI+NDF  PG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGE G VIRGKKG GGITVKKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 23. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 191.7 bits 752,  Expect = 6e-51
 Identities = 100/131 76%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G HL+SAAI+G+D +VWAQS NFPQ+KPEE++ I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPG VIRGKKG GG+TVKKT +AL+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 24. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 191.4 bits 751,  Expect = 7e-51
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMC+IDG+HL++AAILGHD +VWAQS  FP+FKPEEI+AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GG+TVKKT+ AL+ G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 25. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 191.2 bits 750,  Expect = 8e-51
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HL+SAAI+GHD TVWAQS  FPQFKPEE++ I+ DF+ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 26. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 191.2 bits 750,  Expect = 8e-51
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+IDG+ L++AAI+GHD +VWAQS  FPQFK +E++A++ DF+ PGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GGITVKKT  ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 27. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 190.9 bits 749,  Expect = 9e-51
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HL+SAAILGHD TVWAQS +FPQFKPEEI+ I+ DF+ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GGIT+KKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 28. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 190.7 bits 748,  Expect = 1e-50
 Identities = 102/130 78%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMCEI+G+HL+SAAI+GHD TVWAQS  FP FKPEE++ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+TVKKT  AL+IG+YDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLLEQG 130
            +LGDYL+EQG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 29. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 190.7 bits 748,  Expect = 1e-50
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+IDG+ L++AAI+GHD +VWAQS +FPQFK +E++A++ DF+ PGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GGITVKKT  ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYLL+QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 30. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 190.7 bits 748,  Expect = 1e-50
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMC+IDG  L++AAILG+D +VW+QS  FP FKPEEI+AIL DF+ PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GGITVKKTN ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 190.4 bits 747,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAY D+HLMCEI+G  L++AAI+GHD +VWAQS  FPQ+KPEEI+ ++NDF  PGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GG+TVKKT+ ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 32. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 190.4 bits 747,  Expect = 1e-50
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HL+CE +G HL+SAAI+G+D TVWAQS NFPQFKPEEI+ I+NDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP  VIRGKKG GGIT+KKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 33. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 190.4 bits 747,  Expect = 1e-50
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HL+CE +G HL+SAAI+G+D TVWAQS NFPQFKPEEI+ I+NDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP  VIRGKKG GGIT+KKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 34. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 190.2 bits 746,  Expect = 2e-50
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+I+G  L+SAAI+GHD +VWA S +FPQF  EE+SAI+ DFE PGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TVKKTN ALIIGVYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 190.2 bits 746,  Expect = 2e-50
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HL+SAAILGHD TVWAQS +FPQFKPEEI+ I+ DF+ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GGIT+KKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 36. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 190.2 bits 746,  Expect = 2e-50
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HL+SAAILGHD TVWAQS +FPQFKPEEI+ I+ DF+ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GGIT+KKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 37. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 189.9 bits 745,  Expect = 2e-50
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+IDG+ L++AAI+GHD +VWAQS +FPQFK +E++AI+ DF+ PGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT+ ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 38. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 189.7 bits 744,  Expect = 2e-50
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMC++DG+ L+SAAILGHD +VWAQS  FP++KP EI+AILNDF  PGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTG+Y+ G KYMVIQGEPGVVIRGKKG+GG+T+KK+N+ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 39. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 189.7 bits 744,  Expect = 2e-50
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HL+CEI+G HLSSAAILG+D  VWAQS +FPQFKPEEI+AI+NDF  PGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG +I GKKG GG+T++KTN ALIIG+YD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 40. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 189.7 bits 744,  Expect = 2e-50
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HL+SAAI+GHD   WAQS  FP+FKPEE++AI+ DF+ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGITVKKT  +LIIG+YDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 41. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 189.7 bits 744,  Expect = 2e-50
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMC+IDG  L++AAILG+D +VW+QS +FP FKPEEI+AIL DF+ PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GGIT+KKT+ AL+IG+YDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 42. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 189.2 bits 742,  Expect = 3e-50
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+IDG  L++AAILG+D +VW+QS  FP FKPEEI+AIL DF+ PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GGITVKKTN ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 189.2 bits 742,  Expect = 3e-50
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+IDG  L++AAILG+D +VW+QS  FP FKPEEI+AIL DF+ PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GGITVKKTN ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 44. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 189.2 bits 742,  Expect = 3e-50
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HLSSAAI+GHD  VWAQS  FPQFKPEE++ I+ DF+ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT  AL+IG+YDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 45. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 189.0 bits 741,  Expect = 4e-50
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMC+IDG  L++AAILG+D +VW+QS  FP FKPEEI+AIL D++ PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GGITVKKTN ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 188.0 bits 737,  Expect = 7e-50
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+ LMCEI+G HL++AAI+G+D +VWAQS NFPQFK EEI+AI++DF+ PG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TV+KTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 47. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 187.2 bits 734,  Expect = 1e-49
 Identities = 99/131 75%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDD LMC+IDG+HL++AAILGHD +VWA+S  FP+FKPEEI+AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GG+TVKKT  AL+ G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 48. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 187.2 bits 734,  Expect = 1e-49
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQAYVDDHLMCEI+G   HL+ AAILG D +VWAQS +FPQFKP+EI+AI+ DF+ PG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKG GGI VKKT  AL++G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGF 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 49. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 186.5 bits 731,  Expect = 2e-49
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ Y D+HLMCEI+G  L++AAI+GHD +VWAQS  FPQ+KPEEI+ ++NDF  PGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIR KKG GG+TVKKT+ ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 186.3 bits 730,  Expect = 2e-49
 Identities = 98/130 75%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVD+HLMCEI+G+HL+SAAI+GHD TVWAQS +FPQFKPEEI+ I+ D++ PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPG VIRGKKG GGIT+KKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 51. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 186.0 bits 729,  Expect = 3e-49
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVDDHLMCEI+G   HLS+AAILG D +VWAQS +FPQFKP+EISA++ DF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKG GGI VKKT  ALIIG+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 52. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 185.0 bits 725,  Expect = 6e-49
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVDDHLMC+IDG  L++AAILG+D +VW+QS  FP F+ EEI+AIL DF+ PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GGI VKKTN ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 184.8 bits 724,  Expect = 7e-49
 Identities = 99/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQAYVD+HLMCEI+G+HL++AAI+GHD   WAQS  FP+FK E+++ I+ DF+ PG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 54. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 184.3 bits 722,  Expect = 1e-48
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIDG---QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
            MSWQ YVDDHLMCE+DG   Q+LS+AAI+GHD +VWAQS  FP+FKPEEI+ I+ +F+ P
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP  VIRGKKG+GG+T+KKT  AL+ GVYDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLLEQGF 131
            +VERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 55. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 184.0 bits 721,  Expect = 1e-48
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIDGQ--HLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVD+HLMC+IDGQ  HL++AAI+GHD +VWAQS NFPQFK EEIS I+ DFE PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
             LAPTGL+LGGTKYMVIQGE G VIRGKKG+GG+T+KKT+ AL+ G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGF 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 56. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 182.6 bits 715,  Expect = 3e-48
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMC+++G  L++AAILG+D +VWAQS NFPQ+KPEEI  I NDF  PG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP  VIRGKKG GG+T+KKT  A++ G+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 57. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 182.1 bits 713,  Expect = 4e-48
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDGQ--HLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVDDHLMC+IDGQ  HL++A+I+GHD ++WAQS +FPQ+KPEEI+ I+ DF+ PG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
             LAPTGLY+ GTKYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 58. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 181.3 bits 710,  Expect = 7e-48
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCEI-DGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGS 59
            MSWQAYVDDHLMC++ DG   +SAAI+GHD +VWAQS NFPQ+KPEE++ I+NDF   G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE G VIRGKKG+GG T+KKT  A++IG+YDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLLEQGF 131
            ERLGDYLLEQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 59. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 181.3 bits 710,  Expect = 7e-48
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIDG---QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
            MSWQAYVDDHLMCE++G   Q L++AAI+GHD +VWAQS  FPQ KPEEI+ I+ DF+ P
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP  VIRGKKG+GG+T+KKT  AL+ GVYDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLLEQGF 131
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 60. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 181.1 bits 709,  Expect = 9e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIDGQH---LSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
            MSWQAYVDDHLMC+I+G+    L++AAI+GHD +VWAQS  FPQFKPEE++ I+ DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGF 131
            VVERLGDYLLEQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 61. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 180.3 bits 706,  Expect = 1e-47
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            M WQ YVDDHLMCEI+G   HLS AAILG D +VWAQS +FPQFKP+EI+A++ DF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG  IRGKKG GGI VKKT  AL+ G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 62. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 179.8 bits 704,  Expect = 2e-47
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIDGQH---LSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
            MSWQAYVDDHLMC+I+G+    L++AAI+GHD +VWAQS  FPQFKPEE++ I+ DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGF 131
            V ERLGDYLLEQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 63. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 179.8 bits 704,  Expect = 2e-47
 Identities = 98/130 75%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEIDGQH---LSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
            MSWQAYVDDHLMC+I+G+    L++AAI+GHD +VWAQS  FPQFKPEE++ I+ DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQG 130
            VVERLGDYL+EQG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 64. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 179.4 bits 702,  Expect = 3e-47
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVDDHLMC+I+G   HL+ AAILG D +VWAQS NFPQFKP+EI+AI+ +F+ PG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKG GGI VKKT  ALI G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 65. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 178.9 bits 700,  Expect = 4e-47
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIDGQ--HLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVD+HLMC+IDGQ  HL++AAI+GHD ++WAQS +FPQ+K +EI+ I  DFE PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
             LAPTGL+L GTKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGF 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 66. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 178.6 bits 699,  Expect = 5e-47
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVDDHLMCEI+G   HL++AAILG D +VWAQS NFPQFKP+EISA++ +F+  G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKG GGI VKKT  ALI G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 67. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 178.4 bits 698,  Expect = 6e-47
 Identities = 99/129 76%, Positives = 115/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCEI-DGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGS 59
            MSWQAYVDDHLMC++ DG  L+SAAI+GHD +VWAQS NFPQ+KPEE++ I+NDF   G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE G VI GKKG+GG T+KKT  A++IG+YDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQG 130
            ERLGDYLLEQG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 68. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 177.6 bits 695,  Expect = 9e-47
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIDGQHLSS--AAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVD+HLMC+IDGQ  +S  +AI+GHD +VWAQS +FPQFKP+EI+ I+ DFE PG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGF 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 69. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 177.6 bits 695,  Expect = 1e-46
 Identities = 97/130 74%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEIDGQH---LSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
            MSWQAYVDDHLMC+I+G+    L++AAI+GHD +VWAQS  FPQFKPEEI+ I+ DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
            G+LAPTGL+LGGTKYMVIQGE G VIRGKKG+GGIT+KKTN AL+ G+Y+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQG 130
            VV RLGD L++QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 70. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 176.4 bits 690,  Expect = 2e-46
 Identities = 95/130 73%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQAYVD+HLMC+I+G  QHL+SAAILG D TVWAQS  FPQFKPEE+  I+ +F+  G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTG+++ G KYMV+QGEPG VIRGKKG GGI +KKT  A+I+G+YDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQG 130
            VERLGDYLLEQG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 71. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 175.0 bits 684,  Expect = 6e-46
 Identities = 94/128 73%, Positives = 110/128 85%, Gaps = 0/128 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ+YVDDHLMC+++G HL++AAILG+D +VWAQS  FPQ+KP+EI  I  DFE PG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
            APTGL+LGG KYMVIQGE G VIRGKKG GG+T+KKTN AL+ G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLLE 128
            RLGDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 72. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 173.2 bits 677,  Expect = 2e-45
 Identities = 94/131 71%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEID--GQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQAYVD+HLMC I+  G HL+S+AI+G D ++WAQS NFPQ KP+EI AI  +F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMVIQGEPG VIRGKKG GG+ +KKT  ALI G+YDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGF 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 73. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 172.7 bits 675,  Expect = 3e-45
 Identities = 94/130 72%, Positives = 110/130 84%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVDDHLMC+I+G  QHL+SAAI+G D TVWA+S +FP+FKP EI AI+ +F   G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE G VIRGKKG GGI +KKT  A++ G+YDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQG 130
            VERLGDYLL+QG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 170.0 bits 664,  Expect = 2e-44
 Identities = 90/129 69%, Positives = 111/129 86%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
            MSWQ YVDDHLMC+I+G  QHL++AAILG D TVWA+S  FP+FKPEE+  I+N+F   G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMV+QGE G VIRGKKG GGI +KKT  A+++G+YDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLLEQ 129
            VERLGDYL++Q
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 159.1 bits 619,  Expect = 3e-41
 Identities = 86/109 78%, Positives = 99/109 90%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
            MSWQ YVDDHLMCEI+G +L+SAAI+G+D ++WAQS +FPQFKPEEI+AI+NDF  PG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEP 109
            APTGLYLGGTKYMVIQGE G VIRGKKG GG+TVKKTN ALIIG+YDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 127.1 bits 490,  Expect = 2e-31
 Identities = 97/131 74%, Positives = 118/131 90%, Gaps = 28/131 21%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQ------------------- 41
            MSWQ YVDDHLMC+++G+HL+SAAILG D +VWAQSP FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEISAILNDFENPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGI 92
                     FKPEEI+ I+ DF+ PG LAPTGL+LGGTKYMVIQGEPG VIRGKKG+ GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTNLALIIGVYDEPMTPGQCNMVVERLGDYLLEQGF 131
            T+KKT  ALI G+Y+EP+TPGQCNMVVE++GDYL++QG+
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.7 bits 276,  Expect = 9e-16
 Identities = 50/122 40%, Positives = 76/122 62%, Gaps = 8/122 6%
Query  1    MSWQAYVDDHLMCEIDGQHLSSAAILG-HDSTVWAQ-SPNFP-QFKPEEISAILNDFE-N 56
            MSWQ+YVD+++   +D +    A I G +D  VWA+   ++P Q   +E+  I +    N
Sbjct  1    MSWQSYVDNQICQHVDCRL---AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCN 116
            P S+   G++LGG KY+ IQ +  +V RG+KG+  + +  TN  L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQADNSLV-RGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.