The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL
APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE
RLGDYLIDQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9XF40 Mal d 4 131 897 218.8 3.8e-59
Q9XF38 Pyr c 4 131 873 213.2 1.9e-57
Q9M7N0 Hev b 8.0201 131 819 200.4 1.3e-53
A0A2I4DNN6 Jug r 7.0101 131 815 199.5 2.5e-53
Q9LEI8 Hev b 8.0204 131 807 197.6 9.1e-53
Q9M7M8 Hev b 8.0203 131 795 194.8 6.4e-52
Q8L5D8 Pho d 2.0101 131 787 192.9 2.4e-51
Q9M7M9 Hev b 8.0202 131 784 192.2 3.9e-51
AAL07320 Lit c 1 131 783 192.0 4.6e-51
O24169 Ole e 2 134 781 191.5 6.5e-51
O24170 Ole e 2 134 781 191.5 6.5e-51
O24171 Ole e 2 134 776 190.3 1.5e-50
CAD37201 Pru p 4.0101 131 775 190.1 1.7e-50
QVU02258 Que ac 2.0101 133 774 189.8 2e-50
AY081852 Pru du 4.0102 131 769 188.7 4.5e-50
AY081850 Pru du 4.0101 131 769 188.7 4.5e-50
Q9XF39 Pru av 4 131 768 188.4 5.3e-50
AAL29690 Lyc e 1 131 768 188.4 5.3e-50
O49894 Mer a 1 133 768 188.4 5.4e-50
P25816 Bet v 2 133 767 188.2 6.3e-50
O65812 Hev b 8.0101 131 764 187.5 1e-49
O04725 Cyn d 12 131 762 187.0 1.4e-49
Q9FUD1 Ory s 12.0101 131 762 187.0 1.4e-49
AAL76933 Dau c 4 134 762 187.0 1.4e-49
XP030492464 Can s 2.0101 133 761 186.8 1.7e-49
AF377948 Mus a 1.0101 131 759 186.3 2.3e-49
QRN65366 Lig v 2.0101 134 759 186.3 2.3e-49
O65809 Gly m 3 131 756 185.6 3.7e-49
Q9XF42 Mal d 4 131 756 185.6 3.7e-49
AAL92870 Che a 2 131 756 185.6 3.7e-49
QID21357 Pop n 2.0101 131 756 185.6 3.7e-49
P35081 Zea m 12.0101 131 754 185.1 5.2e-49
Q9XF37 Api g 4 134 753 184.9 6.3e-49
P84177 Cit s 2.0101 131 752 184.7 7.2e-49
Q9AXH4 Cor a 2 131 751 184.4 8.5e-49
P49233 Tri a 12.0102 141 751 184.4 9.1e-49
O24650 Phl p 12.0102 131 750 184.2 1e-48
P35083 Zea m 12.0103 131 749 184.0 1.2e-48
O65810 Gly m 3 131 749 184.0 1.2e-48
CAD37202 Pru p 4.0201 131 746 183.2 1.9e-48
A0A0A0REA1 Koc s 2.0101 133 746 183.2 1.9e-48
Q9STB6 Hev b 8.0102 131 743 182.5 3.1e-48
FM164277 Tri a 12.0104 131 743 182.5 3.1e-48
CAA54686 Phl p 12.0101 131 743 182.5 3.1e-48
P35079 Phl p 12.0101 131 743 182.5 3.1e-48
ACP43298 Ama r 2.0101 133 743 182.5 3.2e-48
CAD10376 Cap a 2 131 742 182.3 3.7e-48
Q9XF41 Mal d 4 131 741 182.1 4.3e-48
P49232 Tri a 12.0101 138 741 182.1 4.6e-48
P35082 Zea m 12.0102 131 738 181.4 7.1e-48
Q9FR39 Zea m 12.0105 131 738 181.4 7.1e-48
AAK01235 Cor a 2 131 735 180.7 1.2e-47
ACS34771 Sal k 4.0101 133 735 180.7 1.2e-47
O22655 Zea m 12.0104 131 734 180.4 1.4e-47
AAK54835 Ana c 1 131 734 180.4 1.4e-47
A0A023W2L7 Pro j 2.0101 133 732 180.0 1.9e-47
O24282 Phl p 12.0103 131 731 179.7 2.2e-47
Q5XWE1 Citr l 2.0101 131 730 179.5 2.6e-47
P52184 Hor v 12.0101 131 727 178.8 4.3e-47
P49234 Tri a 12.0103 140 726 178.5 5.4e-47
AAP13533 Cuc m 2 131 722 177.6 9.6e-47
ABU95412 Sin a 4.0101 131 722 177.6 9.6e-47
A0A0A0RCW1 Aca f 2 133 721 177.4 1.2e-46
Q9SQI9 Ara h 5 131 718 176.7 1.9e-46
Q5EF31 Cro s 1.0101 131 717 176.4 2.2e-46
Q9XG85 Par j 3 132 710 174.8 6.9e-46
AJ421030 Art v 4.0101 133 709 174.5 8.2e-46
Q42449 Ara t 8 131 699 172.2 4.1e-45
CAD10377 Lyc e 1 131 698 171.9 4.9e-45
Q93YG7 Sola l 1.0101 131 698 171.9 4.9e-45
Q9T0M8 Par j 3 131 697 171.7 5.7e-45
AJ421031 Art v 4.0201 133 688 169.6 2.5e-44
O81982 Hel a 2 133 683 168.4 5.7e-44
ADK22841 Sal k 4.0201 133 679 167.5 1.1e-43
FG438715 Act d 9.0101 109 607 150.5 1.1e-38
QEQ43417 Sola m 1.0101 159 542 135.2 6.8e-34
A0A1B2YLJ4 Tyr p 36.0101 131 272 71.6 7.8e-15
C0HJX6 Pla l 2.0101 42 107 32.7 0.0013
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 218.8 bits 897,  Expect = 4e-59
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 2. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 213.2 bits 873,  Expect = 2e-57
 Identities = 128/131 97%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMCDIDGHHLTAAAILGHDGSVWA+SSTFPKFKPEEITAIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKT QALVFGIYEEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 200.4 bits 819,  Expect = 1e-53
 Identities = 114/131 87%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMCDIDGHHLTAAAI+GHDGSVWA+SS+FP+FKPEE+ AIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKGSGG+TVKKTGQAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 4. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 199.5 bits 815,  Expect = 2e-53
 Identities = 114/131 87%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+IDG+HLTAAAI+GHDGSVWA+SS+FP+FKPEEI AIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG+GG+TVKKTGQAL+FGIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 5. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 197.6 bits 807,  Expect = 9e-53
 Identities = 113/131 86%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDIDGH LTAAAI+GHDGSVWA+SS+FP+FK +E+ A+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKGSGG+TVKKTGQAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 194.8 bits 795,  Expect = 6e-52
 Identities = 111/131 84%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDIDGH LTAAAI+GHDGSVWA+SS FP+FK +E+ A+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKGSGG+TVKKTGQAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 192.9 bits 787,  Expect = 2e-51
 Identities = 112/131 85%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVD+ LMC+IDGHHLTAAAILGHDGSVWA+SS+FP+FK EEIT IM DF+EPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGGVTVKKT QAL+FGIYEEP+TPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 8. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 192.2 bits 784,  Expect = 4e-51
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDIDGH LTAAAI+GHDGSVWA+SS+FP+FK +E+ AIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 9. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 192.0 bits 783,  Expect = 5e-51
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMC+ DG+HLTAAAI+GHDGSVWA+S+ FP+FKP EI AIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG GG+TVKKT QAL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 10. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 191.5 bits 781,  Expect = 6e-51
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 3/131 2%
Query  1    MSWQAYVDDRLMCDIDGHH---LTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
            MSWQAYVDD LMCDI+GH    LTAAAI+GHDGSVWA+S+TFP+FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            +VERLGDYL++QG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 11. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 191.5 bits 781,  Expect = 6e-51
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 3/131 2%
Query  1    MSWQAYVDDRLMCDIDGHH---LTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
            MSWQAYVDD LMCDI+GH    LTAAAI+GHDGSVWA+S+TFP+FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            +VERLGDYL++QGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 12. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 190.3 bits 776,  Expect = 1e-50
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDRLMCDIDGHH---LTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
            MSWQAYVDD LMCDI+GH    LTAAAI+GHDGSVWA+S+TFP+FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            + ERLGDYL++QGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 13. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 190.1 bits 775,  Expect = 2e-50
 Identities = 111/131 84%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMCDIDG+ LTAAAILG+DGSVW++S+TFP FKPEEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 14. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 189.8 bits 774,  Expect = 2e-50
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDGH--HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVD+ LMCDIDG+  HL AAAI+GHDGSVWA+SS FP+FK EEI+ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
             LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGGVT+KKT QALVFGIYEEP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 15. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 188.7 bits 769,  Expect = 4e-50
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDIDG+ LTAAAILG+DGSVW++S+TFP FKPEEI AI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 16. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 188.7 bits 769,  Expect = 4e-50
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDIDG+ LTAAAILG+DGSVW++S+TFP FKPEEI AI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 17. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 188.4 bits 768,  Expect = 5e-50
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMCDIDG+ LTAAAILG+DGSVW++S+TFP FKPEEI AI+KD+D+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 18. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 188.4 bits 768,  Expect = 5e-50
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDI+G+HLT+AAI+G+DGSVWA+S+ FP+FKPEEITAIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG+GG+TVKKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDY+I+QGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 19. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 188.4 bits 768,  Expect = 5e-50
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDGH--HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVDD LMCDIDG+  HL AA+I+GHDGS+WA+S++FP++KPEEIT IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYLI+QG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 20. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 188.2 bits 767,  Expect = 6e-50
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDGH--HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVD+ LMCDIDG+  +  A+AI+GHDGSVWA+SS+FP+FKP+EIT IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
             LAPTGLHLGG KYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYLIDQGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 21. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 187.5 bits 764,  Expect = 1e-49
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+RLMC+I+G+HLTAAAI+G+DGSVWA+SS FP+FK EEITAIM DFDEPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG GGVTV+KT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 22. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 187.0 bits 762,  Expect = 1e-49
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMC+I+GHHLT+AAI+GHDG+VWA+S+ FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGVTVKKTGQALV GIY+EP+TPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIDQGL 131
            +LGDYLI+QG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 23. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 187.0 bits 762,  Expect = 1e-49
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHLT+AAI+GHDG+VWA+S+ FP+FKPEE+T IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGG+TVKKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 24. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 187.0 bits 762,  Expect = 1e-49
 Identities = 110/131 83%, Positives = 125/131 95%, Gaps = 3/131 2%
Query  1    MSWQAYVDDRLMCDIDGH---HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
            MSWQ YVDD LMC++DG+   +L+AAAI+GHDGSVWA+SSTFPKFKPEEIT IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKGSGGVT+KKTGQALVFG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLIDQGL 131
            IVERLGDYLI+QGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 25. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 186.8 bits 761,  Expect = 2e-49
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDGH--HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVD+ LMCDIDG+  HLTAAAI+GHDGS+WA+SS+FP++K +EIT I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
             LAPTGLHL GTKYMVIQGE GAVIRGKKGSGGVT+KKTGQAL+FGIYEEP+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 26. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 186.3 bits 759,  Expect = 2e-49
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD L+CDIDG+ LTAAAI+GHDGSVWA+S  FP+ KPEEI AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGSGGVT+KKT  AL+ GIY EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL DQG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 27. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 186.3 bits 759,  Expect = 2e-49
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDRLMCDIDGHH---LTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
            MSWQAYVDD LMCDI+GH    LTAAAI+GHDGSVWA+S+TFP+FKPEEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
            G+LAPTGLHLGGTKYMVIQGE GAVIRGKKGSGG+T+KKT QALVFGIYEEP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            +V RLGD L+ QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 28. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 185.6 bits 756,  Expect = 4e-49
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD L+CDI+G+HLT AAI+G+DGSVWA+S+ FP+FKPEEITAIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKTG AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 185.6 bits 756,  Expect = 4e-49
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMCDIDG+ LTAAAILG+DGSVW++S++FP FKPEEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+ GIY+EP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 30. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 185.6 bits 756,  Expect = 4e-49
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDI+G+HL++AAILGHDG+VWA+S +FP++KPEE++AIMKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGLHLGGTKYMVIQGE G VIRGKKG GGVT+KKT QAL+ GIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            R+GDYL++QG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 31. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 185.6 bits 756,  Expect = 4e-49
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCDI+G+ LT+AAI+GHDGSVWA S++FP+F  EE++AIMKDF+EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGVTVKKT QAL+ G+Y+EPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 32. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 185.1 bits 754,  Expect = 5e-49
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHLT+AAI+GHDG+ WA+S+ FP+FKPEE+ AIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKTGQ+L+ GIY+EP+TPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 33. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 184.9 bits 753,  Expect = 6e-49
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDRLMCDIDGHH---LTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
            MSWQAYVDD LMC+++G+    LTAAAI+GHDGSVWA+SSTFP+ KPEEI  IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGGVT+KKTGQALVFG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLIDQGL 131
            IVERLGDYLIDQGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 34. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 184.7 bits 752,  Expect = 7e-49
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMCDIDG+ LTAAAILG+DGSVW++S+TFP F+ EEI AI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+ VKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 184.4 bits 751,  Expect = 8e-49
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAY D+ LMC+I+G+ L AAAI+GHDGSVWA+SSTFP++KPEEIT +M DF+EPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 184.4 bits 751,  Expect = 9e-49
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD L C+IDG+HLT+AAILGHDGSVWA S  FPKFKPEEI  I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG AL++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 37. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 184.2 bits 750,  Expect = 1e-48
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHL +AAILGHDG+VWA+S+ FP+FKPEEIT IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTG+ + G KYMVIQGE GAVIRGKKG+GG+T+KKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 38. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 184.0 bits 749,  Expect = 1e-48
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHL++AAI+GHDG+VWA+S+ FP+FKPEE+T I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            AP GL LG TKYMVIQGE GAVIRGKKGSGG+TVKKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 39. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 184.0 bits 749,  Expect = 1e-48
 Identities = 106/130 81%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD L+C I+G+HLT AAI+G+DGSVW +S+ FP+FKPEEITAIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKTG AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 183.2 bits 746,  Expect = 2e-48
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMC+I+G+HL+AAAI+GHDGSVWA+S+TFP++KPEE+T I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKK+  AL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 41. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 183.2 bits 746,  Expect = 2e-48
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVDD LMCDI+G  +HLT AAILG DGSVWA+S+ FP+FKP+EI AI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+ VKKTGQAL+FGIY+EP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 42. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 182.5 bits 743,  Expect = 3e-48
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMC+I+G+HL+AAAI+G+DGSVWA+S+ FP+FK EEIT IM DF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GGVTVKKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 43. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 182.5 bits 743,  Expect = 3e-48
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSW+AYVDD L C+IDG+HLT+AAILGHDGSVWA+S  FP+FKPEEI  I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG AL++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 182.5 bits 743,  Expect = 3e-48
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHL +AAILGHDG+VWA+S+ FP+FKPEEIT IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTG+ + G KYMVIQGE G VIRGKKG+GG+T+KKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 45. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 182.5 bits 743,  Expect = 3e-48
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHL +AAILGHDG+VWA+S+ FP+FKPEEIT IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTG+ + G KYMVIQGE G VIRGKKG+GG+T+KKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 46. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 182.5 bits 743,  Expect = 3e-48
 Identities = 107/130 82%, Positives = 122/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQAYVDD LMC+I+G  +HLT AAILG DGSVWA+S+ FP+FKP+EI AI++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GG+ VKKTGQALV GIY+EP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 47. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 182.3 bits 742,  Expect = 4e-48
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMC+I+G+ LT+AAI+G+DGSVWA+S+TFP+FKPEEITAIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 48. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 182.1 bits 741,  Expect = 4e-48
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMC+I+G+HL+AAAI+GH+GSVWA+S+TFP++KPEE+T IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGVTVKK+  AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 49. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 182.1 bits 741,  Expect = 5e-48
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD L C+IDG+HLT+AAILGHDGSVW  S  FPKFKPEEI  I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG AL++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 50. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 181.4 bits 738,  Expect = 7e-48
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVD+ LMC+I+GHHL AAAI+GHDG+ WA+S+ FP+FK E++  IMKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGG+TVKKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 51. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 181.4 bits 738,  Expect = 7e-48
 Identities = 98/131 74%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD L+CDI+G+HL+AAAI+GHDGSVWA+S  FP++KPEE+  ++KDFDEPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG+GG+T+KKTG +L+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 52. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 180.7 bits 735,  Expect = 1e-47
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ Y D+ LMC+I+G+ L AAAI+GHDGSVWA+SSTFP++KPEEIT +M DF+EPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIR KKG GGVTVKKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 53. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 180.7 bits 735,  Expect = 1e-47
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVDD LMC+I+G  +HLTAAAILG DGSVWA+S+ FP+FKP+EI+A++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+ VKKTGQAL+FGIY+EP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 54. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 180.4 bits 734,  Expect = 1e-47
 Identities = 97/131 74%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVD+ LMC+I+G+HL+AAAI+GHDGSVWA+S +FP++KPEE+  I+KDFDEPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG+GG+T+KKTG +L+ G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 55. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 180.4 bits 734,  Expect = 1e-47
 Identities = 99/131 75%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMC+IDG+HL++AAILGHD +VWA+S  FP+FKPEEI+AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG+GG+TVKKT  AL+ G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 56. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 180.0 bits 732,  Expect = 2e-47
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVDD LMC+I+G  +HL+AAAILG DGSVWA+S++FP+FKP+EI+A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+ VKKTGQAL+ GIY+EP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 57. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 179.7 bits 731,  Expect = 2e-47
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+GHHL +AAI+GHDG+VWA+S+ FP+FKPEEIT IMKD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTG+ +   KYMVIQGE GAVIRGKKG+GG+T+KKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 58. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 179.5 bits 730,  Expect = 3e-47
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQAYVDD LMC+I+G+HLT+AAI+G+DGSVWA S  FP++KPEEIT I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL++GG+KYMVIQGE GAVIRGKKG GGVTVKKT  ALV GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 59. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 178.8 bits 727,  Expect = 4e-47
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD L C+IDG+HLT+AAILGHDG VW +S  FP+FKPEEI  I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG  L++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 60. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 178.5 bits 726,  Expect = 5e-47
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSW+AYVDD L C+IDG++LT+AAILGHDGSVWA+S  FP+FKPEE   I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG AL++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 61. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 177.6 bits 722,  Expect = 1e-46
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMC+I+G+HLT+AAI+G+DGSVWA+S  FP++KPEE+  I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GGVTVKKTG ALV GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 62. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 177.6 bits 722,  Expect = 1e-46
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMCD++G+ LTAAAILG+DGSVWA+S+ FP++KPEEI  I  DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL +GGTKYMVIQGE  AVIRGKKG+GGVT+KKT QA+VFGIYEEP+TPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 63. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 177.4 bits 721,  Expect = 1e-46
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            M WQ YVDD LMC+I+G  +HL+ AAILG DGSVWA+S++FP+FKP+EI A++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGLHLGGTKYMVIQGE G  IRGKKG GG+ VKKTGQALVFGIY+EP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 64. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 176.7 bits 718,  Expect = 2e-46
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ L+C+I+G HL++AAILG+DG VWA+SS FP+FKPEEITAIM DF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GGVT++KT QAL+ GIY++P+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 65. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 176.4 bits 717,  Expect = 2e-46
 Identities = 97/130 74%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ LMCD+DGH LT+AAILGHDGSVWA+S+ FP++KP EITAI+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGGVT+KK+  AL+FG+Y+EP+TPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 66. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 174.8 bits 710,  Expect = 7e-46
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDRLMCDI-DGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGS 59
            MSWQAYVDD LMCD+ DG+   +AAI+GHDGSVWA+S+ FP++KPEE+T IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIV 119
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIDQGL 131
            ERLGDYL++QGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 67. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 174.5 bits 709,  Expect = 8e-46
 Identities = 98/131 74%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVDD LMCDI+G  +HLT+AAI+G DG+VWA S++FP+FKP EI AI+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
             LAPTGL LGG KYMVIQGE GAVIRGKKG+GG+ +KKTGQA+VFGIY+EP+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 68. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 172.2 bits 699,  Expect = 4e-45
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ+YVDD LMCD++G+HLTAAAILG+DGSVWA+S+ FP++KP+EI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL LGG KYMVIQGE GAVIRGKKG GGVT+KKT QALVFG Y+EP+T GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 69. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 171.9 bits 698,  Expect = 5e-45
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ L+C+ +G+HLT+AAI+G+DG+VWA+S+ FP+FKPEEIT IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 70. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 171.9 bits 698,  Expect = 5e-45
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVD+ L+C+ +G+HLT+AAI+G+DG+VWA+S+ FP+FKPEEIT IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 71. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 171.7 bits 697,  Expect = 6e-45
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDRLMCDI-DGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGS 59
            MSWQAYVDD LMCD+ DG+ L +AAI+GHDGSVWA+S+ FP++KPEE+T IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIDQGL 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 72. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 169.6 bits 688,  Expect = 3e-44
 Identities = 96/131 73%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQ YVDD LMCDI+G  +HLTAAAILG DG+VWA S  FP+FKPEE+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGL LGG KYMV+QGE GAVIRGKKG+GG+ +KKTGQA+V GIY+EP+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQ +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 73. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 168.4 bits 683,  Expect = 6e-44
 Identities = 92/131 70%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQAYVD+ LMCDI+G  +HLT+AAILG DG+VWA+S+ FP+FKPEE+  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTG+ + G KYMV+QGE GAVIRGKKG+GG+ +KKTGQA++ GIY+EP+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 167.5 bits 679,  Expect = 1e-43
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDRLMCDID--GHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
            MSWQAYVD+ LMC+I+  G+HLT++AI+G DGS+WA+SS FP+ KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
            +LAPTGL LGG KYMVIQGE GAVIRGKKG GGV +KKT QAL+FGIY+EP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYLI+QGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 150.5 bits 607,  Expect = 1e-38
 Identities = 85/109 77%, Positives = 101/109 92%, Gaps = 0/109 0%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
            MSWQ YVDD LMC+I+G++LT+AAI+G+DGS+WA+S++FP+FKPEEITAIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEP 109
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKT QAL+ GIY+EP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 135.2 bits 542,  Expect = 7e-34
 Identities = 107/130 82%, Positives = 119/130 91%, Gaps = 28/130 21%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPK------------------- 41
            MSWQ YVDD LMCD++GHHL +AAILG DGSVWA+S  FPK                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGV 92
                     FKPEEIT IMKDFDEPG LAPTGL LGGTKYMVIQGE GAVIRGKKGS G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLIDQG 130
            T+KKTGQAL+FGIYEEP+TPGQCNM+VE++GDYL+DQG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 71.6 bits 272,  Expect = 8e-15
 Identities = 47/123 38%, Positives = 73/123 59%, Gaps = 6/123 4%
Query  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAH-SSTFPK-FKPEEITAIMKDF-DEP 57
            MSWQ+YVD+++   +D      A +  +DG+VWA     +PK    +E+  I       P
Sbjct  1    MSWQSYVDNQICQHVDCRLAVIAGL--QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
             S+   G+HLGG KY+ IQ +  +++RG+KGS  + +  T   L+     + + PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQADN-SLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  IVERLGDYL 126
            +VE+LGDYL
Sbjct  118  VVEKLGDYL 126

Sequence Alignment: 78. Allergen Name: Pla l 2.0101 Sequence ID: C0HJX6

 Score = 32.7 bits 107,  Expect = 0.001
 Identities = 19/28 67%, Positives = 21/28 75%, Gaps = 1/28 3%
Query  56   EPGSLAPTGLHLGGTKYMVIQGEGGAVIR 84
            + GS+   GLHLGG KY VI GE GAVIR
Sbjct  5    QDGSVWAQGLHLGGAKY-VIAGEPGAVIR 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.