The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL
APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE
RLGDYLIEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
Q8L5D8 Pho d 2.0101 131 889 231.9 4.2e-63
Q9M7N0 Hev b 8.0201 131 806 211.0 8.7e-57
Q9XF38 Pyr c 4 131 804 210.5 1.2e-56
Q9M7M9 Hev b 8.0202 131 800 209.4 2.5e-56
A0A2I4DNN6 Jug r 7.0101 131 793 207.7 8.5e-56
Q9FUD1 Ory s 12.0101 131 793 207.7 8.5e-56
Q9M7M8 Hev b 8.0203 131 788 206.4 2e-55
Q9XF40 Mal d 4 131 787 206.2 2.4e-55
Q9STB6 Hev b 8.0102 131 787 206.2 2.4e-55
Q9AXH4 Cor a 2 131 785 205.7 3.5e-55
Q9LEI8 Hev b 8.0204 131 785 205.7 3.5e-55
P35082 Zea m 12.0102 131 785 205.7 3.5e-55
O04725 Cyn d 12 131 784 205.4 4.1e-55
CAD37202 Pru p 4.0201 131 781 204.6 7e-55
P35083 Zea m 12.0103 131 780 204.4 8.3e-55
Q9XF41 Mal d 4 131 778 203.9 1.2e-54
O65812 Hev b 8.0101 131 774 202.9 2.4e-54
O24650 Phl p 12.0102 131 770 201.9 4.8e-54
AAL07320 Lit c 1 131 770 201.9 4.8e-54
AAK01235 Cor a 2 131 769 201.6 5.7e-54
AAK54835 Ana c 1 131 768 201.4 6.8e-54
QVU02258 Que ac 2.0101 133 768 201.3 6.9e-54
AAL92870 Che a 2 131 767 201.1 8.1e-54
AAL29690 Lyc e 1 131 765 200.6 1.1e-53
O24169 Ole e 2 134 765 200.6 1.2e-53
P35081 Zea m 12.0101 131 764 200.3 1.4e-53
CAA54686 Phl p 12.0101 131 763 200.1 1.6e-53
O65809 Gly m 3 131 763 200.1 1.6e-53
P35079 Phl p 12.0101 131 763 200.1 1.6e-53
XP030492464 Can s 2.0101 133 763 200.1 1.7e-53
Q5XWE1 Citr l 2.0101 131 760 199.3 2.8e-53
O65810 Gly m 3 131 760 199.3 2.8e-53
O24282 Phl p 12.0103 131 760 199.3 2.8e-53
CAD10376 Cap a 2 131 759 199.1 3.3e-53
O24170 Ole e 2 134 759 199.1 3.4e-53
AF377948 Mus a 1.0101 131 756 198.3 5.6e-53
QID21357 Pop n 2.0101 131 756 198.3 5.6e-53
Q5EF31 Cro s 1.0101 131 756 198.3 5.6e-53
QRN65366 Lig v 2.0101 134 756 198.3 5.7e-53
O49894 Mer a 1 133 754 197.8 8.1e-53
O24171 Ole e 2 134 754 197.8 8.2e-53
CAD37201 Pru p 4.0101 131 750 196.8 1.6e-52
O22655 Zea m 12.0104 131 749 196.6 1.9e-52
Q93YG7 Sola l 1.0101 131 748 196.3 2.3e-52
CAD10377 Lyc e 1 131 748 196.3 2.3e-52
Q9XF42 Mal d 4 131 748 196.3 2.3e-52
AAL76933 Dau c 4 134 748 196.3 2.3e-52
Q9SQI9 Ara h 5 131 746 195.8 3.2e-52
ABU95412 Sin a 4.0101 131 746 195.8 3.2e-52
FM164277 Tri a 12.0104 131 745 195.5 3.8e-52
AY081850 Pru du 4.0101 131 744 195.3 4.6e-52
AY081852 Pru du 4.0102 131 744 195.3 4.6e-52
Q9XF39 Pru av 4 131 743 195.0 5.4e-52
AAP13533 Cuc m 2 131 740 194.3 9.2e-52
P49233 Tri a 12.0102 141 740 194.2 1e-51
P84177 Cit s 2.0101 131 739 194.0 1.1e-51
Q9XF37 Api g 4 134 738 193.8 1.3e-51
P25816 Bet v 2 133 737 193.5 1.6e-51
P52184 Hor v 12.0101 131 734 192.8 2.6e-51
Q9FR39 Zea m 12.0105 131 731 192.0 4.4e-51
P49232 Tri a 12.0101 138 730 191.7 5.7e-51
ACP43298 Ama r 2.0101 133 729 191.5 6.4e-51
P49234 Tri a 12.0103 140 728 191.2 8.2e-51
A0A023W2L7 Pro j 2.0101 133 721 189.5 2.6e-50
Q9XG85 Par j 3 132 715 188.0 7.4e-50
A0A0A0REA1 Koc s 2.0101 133 710 186.7 1.8e-49
ACS34771 Sal k 4.0101 133 709 186.4 2.1e-49
Q9T0M8 Par j 3 131 708 186.2 2.5e-49
A0A0A0RCW1 Aca f 2 133 708 186.2 2.6e-49
Q42449 Ara t 8 131 701 184.4 8.5e-49
O81982 Hel a 2 133 691 181.9 5e-48
ADK22841 Sal k 4.0201 133 689 181.4 7.1e-48
AJ421030 Art v 4.0101 133 681 179.4 2.9e-47
AJ421031 Art v 4.0201 133 675 177.8 8.3e-47
FG438715 Act d 9.0101 109 625 165.3 4e-43
QEQ43417 Sola m 1.0101 159 520 138.6 6.6e-35
A0A1B2YLJ4 Tyr p 36.0101 131 272 76.0 3.8e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 231.9 bits 889,  Expect = 4e-63
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 2. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 211.0 bits 806,  Expect = 9e-57
 Identities = 113/131 86%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMC+IDGHHLTAAAI+GHDGSVWAQSSSFPQFK EE+  IM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 3. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 210.5 bits 804,  Expect = 1e-56
 Identities = 114/131 87%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMC+IDGHHLTAAAILGHDGSVWAQSS+FP+FK EEIT IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGGVTVKKT+QAL+FGIYEEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 4. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 209.4 bits 800,  Expect = 2e-56
 Identities = 112/131 85%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+IDGH LTAAAI+GHDGSVWAQSSSFPQFKS+E+  IM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LGSTKYMVIQGEPGAVIRGKKGSGG+TVKKT+QALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 5. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 207.7 bits 793,  Expect = 9e-56
 Identities = 112/131 85%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEIDG+HLTAAAI+GHDGSVWAQSSSFPQFK EEI  IM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG+GG+TVKKT QALIFGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 207.7 bits 793,  Expect = 9e-56
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHLT+AAI+GHDG+VWAQS++FPQFK EE+TNIM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 7. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 206.4 bits 788,  Expect = 2e-55
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+IDGH LTAAAI+GHDGSVWAQSS FPQFKS+E+  +M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 8. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 206.2 bits 787,  Expect = 2e-55
 Identities = 112/131 85%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+ LMC+IDGHHLTAAAILGHDGSVWA+SS+FP+FK EEIT IM DF+EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGGVTVKKT QAL+FGIYEEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 9. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 206.2 bits 787,  Expect = 2e-55
 Identities = 111/130 85%, Positives = 126/130 96%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMCEI+G+HL+AAAI+G+DGSVWAQS++FPQFKSEEIT IM+DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLY+G TKYMVIQGEPGAVIRGKKG GGVTVKKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 10. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 205.7 bits 785,  Expect = 3e-55
 Identities = 112/131 85%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAY DEHLMCEI+G+ L AAAI+GHDGSVWAQSS+FPQ+K EEIT +MNDFNEPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKG GGVTVKKT+QALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 11. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 205.7 bits 785,  Expect = 3e-55
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+IDGH LTAAAI+GHDGSVWAQSSSFPQFKS+E+  +M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 12. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 205.7 bits 785,  Expect = 3e-55
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVDEHLMCEI+GHHL AAAI+GHDG+ WAQS++FP+FK+E++ NIM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 13. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 205.4 bits 784,  Expect = 4e-55
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMCEI+GHHLT+AAI+GHDG+VWAQS++FP FK EE+ NIM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGGVTVKKT QAL+ GIY+EPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQGM 131
            +LGDYLIEQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 14. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 204.6 bits 781,  Expect = 7e-55
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMCEI+G+HL+AAAI+GHDGSVWAQS++FPQ+K EE+T I+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKG GGVTVKK+  AL+ GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 15. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 204.4 bits 780,  Expect = 8e-55
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHL++AAI+GHDG+VWAQS++FPQFK EE+TNI+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 16. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 203.9 bits 778,  Expect = 1e-54
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMCEI+G+HL+AAAI+GH+GSVWAQS++FPQ+K EE+T IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPG VIRGKKG GGVTVKK+  AL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 17. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 202.9 bits 774,  Expect = 2e-54
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDE LMCEI+G+HLTAAAI+G+DGSVWAQSS+FPQFKSEEIT IM+DF+EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGVTV+KTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 18. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 201.9 bits 770,  Expect = 5e-54
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHL +AAILGHDG+VWAQS+ FPQFK EEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPGAVIRGKKG+GG+T+KKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 19. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 201.9 bits 770,  Expect = 5e-54
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMCE DG+HLTAAAI+GHDGSVWAQS++FPQFK  EI  IM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QALI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 20. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 201.6 bits 769,  Expect = 6e-54
 Identities = 110/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ Y DEHLMCEI+G+ L AAAI+GHDGSVWAQSS+FPQ+K EEIT +MNDFNEPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIR KKG GGVTVKKT+QALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 21. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 201.4 bits 768,  Expect = 7e-54
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMCEIDG+HL++AAILGHD +VWAQS +FPQFK EEI+ I+NDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPG VIRGKKG+GG+TVKKTN ALI G+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 22. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 201.3 bits 768,  Expect = 7e-54
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDGH--HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVDEHLMC+IDG+  HL AAAI+GHDGSVWAQSS+FPQFK+EEI++IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
             LAPTGL+LG TKYMVIQGE GAVIRGKKGSGGVT+KKT+QAL+FGIYEEP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 23. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 201.1 bits 767,  Expect = 8e-54
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+I+G+HL++AAILGHDG+VWAQS SFPQ+K EE++ IM DFNEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GGVT+KKTNQALI GIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            R+GDYL+EQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 24. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 200.6 bits 765,  Expect = 1e-53
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+I+G+HLT+AAI+G+DGSVWAQS++FPQFK EEIT IMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG+GG+TVKKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDY+IEQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 25. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 200.6 bits 765,  Expect = 1e-53
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIDGHH---LTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
            MSWQAYVD+HLMC+I+GH    LTAAAI+GHDGSVWAQS++FPQFK EE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
            G LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGM 131
            VVERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 26. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 200.3 bits 764,  Expect = 1e-53
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHLT+AAI+GHDG+ WAQS++FP+FK EE+  IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT Q+LI GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 27. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 200.1 bits 763,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHL +AAILGHDG+VWAQS+ FPQFK EEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPG VIRGKKG+GG+T+KKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 28. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 200.1 bits 763,  Expect = 2e-53
 Identities = 110/130 84%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HL+C+I+G+HLT AAI+G+DGSVWAQS+ FPQFK EEIT IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKG GGVTVKKT  ALI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            R GDYLI+QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 200.1 bits 763,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHL +AAILGHDG+VWAQS+ FPQFK EEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPG VIRGKKG+GG+T+KKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 30. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 200.1 bits 763,  Expect = 2e-53
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDGH--HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVDEHLMC+IDG+  HLTAAAI+GHDGS+WAQSSSFPQ+K++EIT+I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
             LAPTGL+L  TKYMVIQGEPGAVIRGKKGSGGVT+KKT QALIFGIYEEP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 31. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 199.3 bits 760,  Expect = 3e-53
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMCEI+G+HLT+AAI+G+DGSVWA+S +FPQ+K EEIT I+NDFNEPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLY+G +KYMVIQGEPGAVIRGKKG GGVTVKKT  AL+ GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 32. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 199.3 bits 760,  Expect = 3e-53
 Identities = 110/130 84%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HL+C I+G+HLT AAI+G+DGSVW QS+ FPQFK EEIT IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKG GGVTVKKT  ALI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 199.3 bits 760,  Expect = 3e-53
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+GHHL +AAI+GHDG+VWAQS+ FPQFK EEIT IM D++EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTG+++ + KYMVIQGEPGAVIRGKKG+GG+T+KKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 34. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 199.1 bits 759,  Expect = 3e-53
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMCEI+G+ LT+AAI+G+DGSVWAQS++FPQFK EEIT IMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGE GAVIRGKKG GG+TVKKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 35. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 199.1 bits 759,  Expect = 3e-53
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIDGHH---LTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
            MSWQAYVD+HLMC+I+GH    LTAAAI+GHDGSVWAQS++FPQFK EE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
            G LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGM 131
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 36. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 198.3 bits 756,  Expect = 6e-53
 Identities = 109/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HL+C+IDG+ LTAAAI+GHDGSVWAQS +FPQ K EEI  IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKGSGGVT+KKTN ALI GIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 37. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 198.3 bits 756,  Expect = 6e-53
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+GHDGSVWA S+SFPQF  EE++ IM DF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALI G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 38. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 198.3 bits 756,  Expect = 6e-53
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMC++DGH LT+AAILGHDGSVWAQS+ FP++K  EIT I+NDFNEPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTG+Y+   KYMVIQGEPG VIRGKKGSGGVT+KK+N ALIFG+Y+EPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 39. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 198.3 bits 756,  Expect = 6e-53
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIDGHH---LTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
            MSWQAYVD+HLMC+I+GH    LTAAAI+GHDGSVWAQS++FPQFK EEI  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
            G+LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG+T+KKTNQAL+FGIYEEP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGM 131
            VV RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 40. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 197.8 bits 754,  Expect = 8e-53
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDGH--HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVD+HLMC+IDG+  HL AA+I+GHDGS+WAQS+SFPQ+K EEIT IM DF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
             LAPTGLY+  TKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYLIEQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 41. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 197.8 bits 754,  Expect = 8e-53
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIDGHH---LTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
            MSWQAYVD+HLMC+I+GH    LTAAAI+GHDGSVWAQS++FPQFK EE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
            G LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGM 131
            V ERLGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 42. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 196.8 bits 750,  Expect = 2e-52
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMC+IDG+ LTAAAILG+DGSVW+QS++FP FK EEI  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGG+TVKKTNQALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 196.6 bits 749,  Expect = 2e-52
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVDEHLMCEI+G+HL+AAAI+GHDGSVWAQS SFP++K EE+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPG VIRGKKG+GG+T+KKT  +LI G+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 44. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 196.3 bits 748,  Expect = 2e-52
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHL+CE +G+HLT+AAI+G+DG+VWAQS++FPQFK EEIT IMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEP AVIRGKKG GG+T+KKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 45. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 196.3 bits 748,  Expect = 2e-52
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHL+CE +G+HLT+AAI+G+DG+VWAQS++FPQFK EEIT IMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEP AVIRGKKG GG+T+KKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 46. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 196.3 bits 748,  Expect = 2e-52
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMC+IDG+ LTAAAILG+DGSVW+QS+SFP FK EEI  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT+QAL+ GIY+EP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 47. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 196.3 bits 748,  Expect = 2e-52
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIDGH---HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
            MSWQ YVD+HLMCE+DG+   +L+AAAI+GHDGSVWAQSS+FP+FK EEIT IM +F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
            G LAPTGLYLG TKYMVIQGEP AVIRGKKGSGGVT+KKT QAL+FG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIEQGM 131
            +VERLGDYLIEQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 48. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 195.8 bits 746,  Expect = 3e-52
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD HL+CEI+G HL++AAILG+DG VWAQSS FPQFK EEIT IMNDF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGA+I GKKG GGVT++KTNQALI GIY++PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 49. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 195.8 bits 746,  Expect = 3e-52
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+++G+ LTAAAILG+DGSVWAQS++FPQ+K EEI  I NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEP AVIRGKKG+GGVT+KKT QA++FGIYEEPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 50. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 195.5 bits 745,  Expect = 4e-52
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSW+AYVD+HL CEIDG+HLT+AAILGHDGSVWAQS +FPQFK EEI  I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 51. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 195.3 bits 744,  Expect = 5e-52
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+IDG+ LTAAAILG+DGSVW+QS++FP FK EEI  I+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGG+TVKKTNQALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 52. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 195.3 bits 744,  Expect = 5e-52
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMC+IDG+ LTAAAILG+DGSVW+QS++FP FK EEI  I+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGG+TVKKTNQALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 195.0 bits 743,  Expect = 5e-52
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMC+IDG+ LTAAAILG+DGSVW+QS++FP FK EEI  I+ D+++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGG+TVKKTNQALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 54. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 194.3 bits 740,  Expect = 9e-52
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVDEHLMCEI+G+HLT+AAI+G+DGSVWAQS +FPQ+K EE+  I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGLY+G TKYMVIQGEPGAVIRGKKG GGVTVKKT  AL+ GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 55. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 194.2 bits 740,  Expect = 1e-51
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HL CEIDG+HLT+AAILGHDGSVWA+S +FP+FK EEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 56. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 194.0 bits 739,  Expect = 1e-51
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HLMC+IDG+ LTAAAILG+DGSVW+QS++FP F+ EEI  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKGSGG+ VKKTNQALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGM 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 57. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 193.8 bits 738,  Expect = 1e-51
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIDGHH---LTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
            MSWQAYVD+HLMCE++G+    LTAAAI+GHDGSVWAQSS+FPQ K EEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
            G LAPTGLYLG  KYMVIQGEP AVIRGKKGSGGVT+KKT QAL+FG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIEQGM 131
            +VERLGDYLI+QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 58. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 193.5 bits 737,  Expect = 2e-51
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDGH--HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVDEHLMC+IDG+  +  A+AI+GHDGSVWAQSSSFPQFK +EIT IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
             LAPTGL+LG  KYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYLI+QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 59. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 192.8 bits 734,  Expect = 3e-51
 Identities = 101/130 77%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HL CEIDG+HLT+AAILGHDG VW QS +FPQFK EEI  I+ DF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT   LI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 60. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 192.0 bits 731,  Expect = 4e-51
 Identities = 98/130 75%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQAYVD+HL+C+I+G+HL+AAAI+GHDGSVWAQS +FP++K EE+  ++ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPG VIRGKKG+GG+T+KKT  +LI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 61. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 191.7 bits 730,  Expect = 6e-51
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HL CEIDG+HLT+AAILGHDGSVW +S +FP+FK EEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 62. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 191.5 bits 729,  Expect = 6e-51
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQAYVD+HLMCEI+G  +HLT AAILG DGSVWAQS+ FPQFK +EI  I+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG TKYMVIQGEPGAVIRGKKG+GG+ VKKT QAL+ GIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 63. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 191.2 bits 728,  Expect = 8e-51
 Identities = 102/130 78%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSW+AYVD+HL CEIDG++LT+AAILGHDGSVWAQS +FPQFK EE   I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 64. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 189.5 bits 721,  Expect = 3e-50
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVD+HLMCEI+G  +HL+AAAILG DGSVWAQS+SFPQFK +EI+ ++ DF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG TKYMVIQGEPG VIRGKKG GG+ VKKT QALI GIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 65. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 188.0 bits 715,  Expect = 7e-50
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDEHLMCEI-DGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGS 59
            MSWQAYVD+HLMC++ DG+   +AAI+GHDGSVWAQS++FPQ+K EE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVV 119
            LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG T+KKT QA++ GIY+EPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQGM 131
            ERLGDYL+EQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 66. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 186.7 bits 710,  Expect = 2e-49
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVD+HLMC+I+G  +HLT AAILG DGSVWAQS++FPQFK +EI  I+ +F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG TKYMVIQGE G VIRGKKG GG+ VKKT QALIFGIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 67. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 186.4 bits 709,  Expect = 2e-49
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVD+HLMCEI+G  +HLTAAAILG DGSVWAQS++FPQFK +EI+ ++ +F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG TKYMVIQGE G VIRGKKG GG+ VKKT QALIFGIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 68. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 186.2 bits 708,  Expect = 3e-49
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEI-DGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGS 59
            MSWQAYVD+HLMC++ DG+ L +AAI+GHDGSVWAQS++FPQ+K EE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVV 119
            LAPTGL+LG TKYMVIQGE GAVI GKKGSGG T+KKT QA++ GIY+EPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 69. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 186.2 bits 708,  Expect = 3e-49
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            M WQ YVD+HLMCEI+G  +HL+ AAILG DGSVWAQS+SFPQFK +EI  ++ DF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG TKYMVIQGEPG  IRGKKG GG+ VKKT QAL+FGIY+EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 70. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 184.4 bits 701,  Expect = 9e-49
 Identities = 99/128 77%, Positives = 114/128 89%, Gaps = 0/128 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ+YVD+HLMC+++G+HLTAAAILG+DGSVWAQS+ FPQ+K +EI  I  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
            APTGL+LG  KYMVIQGE GAVIRGKKG GGVT+KKTNQAL+FG Y+EPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIE 128
            RLGDYLIE
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 71. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 181.9 bits 691,  Expect = 5e-48
 Identities = 95/131 72%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQAYVDEHLMC+I+G  +HLT+AAILG DG+VWAQS+ FPQFK EE+  I+ +F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTG+++   KYMV+QGEPGAVIRGKKG+GG+ +KKT QA+I GIY+EP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 72. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 181.4 bits 689,  Expect = 7e-48
 Identities = 99/131 75%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEID--GHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQAYVDEHLMC I+  G+HLT++AI+G DGS+WAQSS+FPQ K +EI  I  +F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG  KYMVIQGEPGAVIRGKKG GGV +KKT QALIFGIY+EP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 73. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 179.4 bits 681,  Expect = 3e-47
 Identities = 94/131 71%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVD+HLMC+I+G  +HLT+AAI+G DG+VWA+S+SFP+FK  EI  I+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
             LAPTGL+LG  KYMVIQGE GAVIRGKKG+GG+ +KKT QA++FGIY+EP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL++QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 177.8 bits 675,  Expect = 8e-47
 Identities = 92/131 70%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
            MSWQ YVD+HLMC+I+G  +HLTAAAILG DG+VWA+S  FP+FK EE+  I+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
            +LAPTGL+LG  KYMV+QGE GAVIRGKKG+GG+ +KKT QA++ GIY+EP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQGM 131
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 165.3 bits 625,  Expect = 4e-43
 Identities = 90/109 82%, Positives = 102/109 93%, Gaps = 0/109 0%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
            MSWQ YVD+HLMCEI+G++LT+AAI+G+DGS+WAQS+SFPQFK EEIT IMNDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEP 109
            APTGLYLG TKYMVIQGE GAVIRGKKG GGVTVKKTNQALI GIY+EP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 138.6 bits 520,  Expect = 7e-35
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 28/130 21%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQ------------------- 41
            MSWQ YVD+HLMC+++GHHL +AAILG DGSVWAQS +FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKSEEITNIMNDFNEPGSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGV 92
                     FK EEITNIM DF+EPG LAPTGL+LG TKYMVIQGEPGAVIRGKKGS G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLIEQG 130
            T+KKT QALIFGIYEEP+TPGQCNMVVE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 76.0 bits 272,  Expect = 4e-16
 Identities = 47/123 38%, Positives = 74/123 60%, Gaps = 6/123 4%
Query  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQ-SSSFP-QFKSEEITNIMNDF-NEP 57
            MSWQ+YVD ++   +D      A +  +DG+VWA+    +P Q   +E+  I +   + P
Sbjct  1    MSWQSYVDNQICQHVDCRLAVIAGL--QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
             S+   G++LG  KY+ IQ +  +++RG+KGS  + +  TN  L+     +   PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  VVERLGDYL 126
            VVE+LGDYL
Sbjct  118  VVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.