The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN
TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV
VERLGDYLIEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
ADK22841 Sal k 4.0201 133 909 238.9 3.6e-65
A0A023W2L7 Pro j 2.0101 133 760 200.8 1e-53
A0A0A0REA1 Koc s 2.0101 133 759 200.5 1.3e-53
A0A0A0RCW1 Aca f 2 133 753 199.0 3.6e-53
ACS34771 Sal k 4.0101 133 748 197.7 8.8e-53
O81982 Hel a 2 133 741 195.9 3e-52
ACP43298 Ama r 2.0101 133 739 195.4 4.3e-52
AJ421030 Art v 4.0101 133 723 191.3 7.4e-51
AAL07320 Lit c 1 131 720 190.6 1.2e-50
Q5XWE1 Citr l 2.0101 131 718 190.0 1.8e-50
AAP13533 Cuc m 2 131 715 189.3 3e-50
ABU95412 Sin a 4.0101 131 712 188.5 5.1e-50
Q9M7N0 Hev b 8.0201 131 711 188.3 6.1e-50
A0A2I4DNN6 Jug r 7.0101 131 710 188.0 7.2e-50
Q9XF42 Mal d 4 131 709 187.7 8.7e-50
CAD37202 Pru p 4.0201 131 708 187.5 1e-49
Q9AXH4 Cor a 2 131 706 187.0 1.5e-49
XP030492464 Can s 2.0101 133 706 187.0 1.5e-49
AAL29690 Lyc e 1 131 705 186.7 1.8e-49
Q9STB6 Hev b 8.0102 131 705 186.7 1.8e-49
O65812 Hev b 8.0101 131 703 186.2 2.5e-49
Q9XF41 Mal d 4 131 703 186.2 2.5e-49
Q9XF37 Api g 4 134 703 186.2 2.6e-49
CAD10377 Lyc e 1 131 702 186.0 3e-49
Q93YG7 Sola l 1.0101 131 702 186.0 3e-49
Q42449 Ara t 8 131 702 186.0 3e-49
O65810 Gly m 3 131 701 185.7 3.6e-49
O65809 Gly m 3 131 701 185.7 3.6e-49
AAL92870 Che a 2 131 701 185.7 3.6e-49
Q9FUD1 Ory s 12.0101 131 699 185.2 5.1e-49
Q9XF38 Pyr c 4 131 699 185.2 5.1e-49
CAD37201 Pru p 4.0101 131 697 184.7 7.3e-49
CAD10376 Cap a 2 131 697 184.7 7.3e-49
QVU02258 Que ac 2.0101 133 697 184.7 7.4e-49
O22655 Zea m 12.0104 131 694 183.9 1.2e-48
O49894 Mer a 1 133 694 183.9 1.3e-48
AJ421031 Art v 4.0201 133 693 183.6 1.5e-48
Q9FR39 Zea m 12.0105 131 692 183.4 1.8e-48
O24650 Phl p 12.0102 131 692 183.4 1.8e-48
AY081852 Pru du 4.0102 131 691 183.1 2.1e-48
AY081850 Pru du 4.0101 131 691 183.1 2.1e-48
AAK01235 Cor a 2 131 690 182.9 2.5e-48
Q9XF39 Pru av 4 131 690 182.9 2.5e-48
P35083 Zea m 12.0103 131 690 182.9 2.5e-48
Q8L5D8 Pho d 2.0101 131 689 182.6 3e-48
P35081 Zea m 12.0101 131 687 182.1 4.3e-48
O04725 Cyn d 12 131 687 182.1 4.3e-48
CAA54686 Phl p 12.0101 131 685 181.6 6.1e-48
P35079 Phl p 12.0101 131 685 181.6 6.1e-48
QID21357 Pop n 2.0101 131 684 181.3 7.3e-48
AAL76933 Dau c 4 134 684 181.3 7.5e-48
Q9M7M8 Hev b 8.0203 131 682 180.8 1e-47
P25816 Bet v 2 133 682 180.8 1.1e-47
Q9LEI8 Hev b 8.0204 131 681 180.6 1.2e-47
Q9M7M9 Hev b 8.0202 131 680 180.3 1.5e-47
Q9XF40 Mal d 4 131 679 180.1 1.8e-47
P84177 Cit s 2.0101 131 679 180.1 1.8e-47
AAK54835 Ana c 1 131 677 179.6 2.5e-47
O24170 Ole e 2 134 677 179.5 2.6e-47
AF377948 Mus a 1.0101 131 676 179.3 3e-47
O24169 Ole e 2 134 676 179.3 3.1e-47
O24282 Phl p 12.0103 131 675 179.0 3.6e-47
Q9SQI9 Ara h 5 131 675 179.0 3.6e-47
FM164277 Tri a 12.0104 131 673 178.5 5.1e-47
O24171 Ole e 2 134 672 178.3 6.3e-47
P49233 Tri a 12.0102 141 668 177.2 1.4e-46
P35082 Zea m 12.0102 131 666 176.7 1.8e-46
P52184 Hor v 12.0101 131 666 176.7 1.8e-46
QRN65366 Lig v 2.0101 134 666 176.7 1.8e-46
Q9XG85 Par j 3 132 659 175.0 6.2e-46
P49232 Tri a 12.0101 138 658 174.7 7.8e-46
P49234 Tri a 12.0103 140 656 174.2 1.1e-45
Q5EF31 Cro s 1.0101 131 654 173.7 1.5e-45
Q9T0M8 Par j 3 131 646 171.6 6.1e-45
FG438715 Act d 9.0101 109 572 152.8 2.4e-39
QEQ43417 Sola m 1.0101 159 473 127.3 1.6e-31
A0A1B2YLJ4 Tyr p 36.0101 131 286 79.6 3.1e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 238.9 bits 909,  Expect = 4e-65
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 2. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 200.8 bits 760,  Expect = 1e-53
 Identities = 103/133 77%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC IE T NHL+++AI+GVDGS+WAQS++FPQ KP EI A+ K+FDGP 
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGEPG VIRGKKGPGG+C+KKT QALI GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 3. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 200.5 bits 759,  Expect = 1e-53
 Identities = 106/133 79%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+IE T NHLT +AI+GVDGS+WAQS+NFPQ KP EI AI KEFD P 
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGE G VIRGKKGPGG+C+KKT QALIFGIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 4. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 199.0 bits 753,  Expect = 4e-53
 Identities = 101/133 75%, Positives = 116/133 87%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            M WQ YVD+HLMC IE T NHL+ +AI+GVDGS+WAQS++FPQ KP EI A+ K+FDGP 
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGEPG  IRGKKGPGG+C+KKT QAL+FGIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 5. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 197.7 bits 748,  Expect = 9e-53
 Identities = 104/133 78%, Positives = 116/133 87%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC IE T NHLT++AI+GVDGS+WAQS+NFPQ KP EI A+ KEFD   
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGE G VIRGKKGPGG+C+KKT QALIFGIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 6. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 195.9 bits 741,  Expect = 3e-52
 Identities = 102/133 76%, Positives = 119/133 89%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVDEHLMC+IE TG HLTS+AI+G+DG++WAQS+ FPQ KP+E++ I KEFD   
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGEPGAVIRGKKG GG+CIKKT QA+I GIYDEPVAPGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 7. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 195.4 bits 739,  Expect = 4e-52
 Identities = 103/132 78%, Positives = 116/132 87%, Gaps = 0/132 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC IE T NHLT +AI+G+DGS+WAQS++FPQ KP EI AI ++FD P 
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGEPGAVIRGKKG GG+C+KKT QAL+ GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 8. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 191.3 bits 723,  Expect = 7e-51
 Identities = 100/133 75%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+IE TG HLTS+AI G DG++WA+S++FP+ KP EI+AI KEF+   
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGE GAVIRGKKG GG+CIKKT QA++FGIYDEPVAPGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 9. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 190.6 bits 720,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC  E  G HLT++AI+G DGS+WAQS+NFPQ KP EI AI K+FD P 
Sbjct  1    MSWQTYVDDHLMC--ETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGEPGAVIRGKKGPGG+ +KKTTQALI GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLVDQGL 131

Sequence Alignment: 10. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 190.0 bits 718,  Expect = 2e-50
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC IE  GNHLTS+AI+G DGS+WA+S NFPQ+KP+EI  I  +F+ P 
Sbjct  1    MSWQAYVDDHLMCEIE--GNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL++GG KYMVIQGEPGAVIRGKKGPGGV +KKT  AL+ GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 11. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 189.3 bits 715,  Expect = 3e-50
 Identities = 100/131 76%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  GNHLTS+AI+G DGS+WAQS NFPQ+KP+E+  I  +F  P 
Sbjct  1    MSWQVYVDEHLMCEIE--GNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL++GG KYMVIQGEPGAVIRGKKGPGGV +KKT  AL+ GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 12. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 188.5 bits 712,  Expect = 5e-50
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC++E  GN LT++AI+G DGS+WAQS+NFPQ+KP+EI+ IN +F  P 
Sbjct  1    MSWQTYVDDHLMCDVE--GNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLF+GG KYMVIQGEP AVIRGKKG GGV IKKTTQA++FGIY+EP+ PGQCNMV
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 188.3 bits 711,  Expect = 6e-50
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC+I+  G+HLT++AI+G DGS+WAQSS+FPQ KP+E+ AI K+FD P 
Sbjct  1    MSWQTYVDEHLMCDID--GHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGEPGAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 14. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 188.0 bits 710,  Expect = 7e-50
 Identities = 101/131 77%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC I+  G HLT++AI+G DGS+WAQSS+FPQ KP+EI AI K+FD P 
Sbjct  1    MSWQTYVDEHLMCEID--GQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ +KKT QALIFGIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 15. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 187.7 bits 709,  Expect = 9e-50
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC+I+  GN LT++AI+G DGS+W+QS++FP  KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMVIQGEPGAVIRGKKG GG+ IKKT+QAL+ GIYDEPV PGQCN+V
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 16. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 187.5 bits 708,  Expect = 1e-49
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC IE  GNHL+++AI+G DGS+WAQS+ FPQ+KP+E+  I  +F+ P 
Sbjct  1    MSWQAYVDDHLMCEIE--GNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKGPGGV +KK+T AL+ GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 17. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 187.0 bits 706,  Expect = 1e-49
 Identities = 99/131 75%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAY DEHLMC IE  GN L ++AI+G DGS+WAQSS FPQ+KP+EI  +  +F+ P 
Sbjct  1    MSWQAYGDEHLMCEIE--GNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKGPGGV +KKT+QALI GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 18. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 187.0 bits 706,  Expect = 2e-49
 Identities = 102/133 76%, Positives = 114/133 85%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC+I+  G HLT++AI+G DGSIWAQSS+FPQ+K QEI  I K+F+ P 
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGL L G KYMVIQGEPGAVIRGKKG GGV IKKT QALIFGIY+EPV PGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 19. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 186.7 bits 705,  Expect = 2e-49
 Identities = 101/131 77%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+IE  GNHLTS+AI+G DGS+WAQS+NFPQ KP+EI AI  +F  P 
Sbjct  1    MSWQTYVDDHLMCDIE--GNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDY+IEQGL
Sbjct  119  VERLGDYIIEQGL 131

Sequence Alignment: 20. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 186.7 bits 705,  Expect = 2e-49
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC IE  GNHL+++AI+G DGS+WAQS+NFPQ K +EI  I  +F  P 
Sbjct  1    MSWQAYVDDHLMCEIE--GNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL++GG KYMVIQGEPGAVIRGKKGPGGV +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 21. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 186.2 bits 703,  Expect = 3e-49
 Identities = 101/131 77%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDE LMC IE  GNHLT++AI+G DGS+WAQSSNFPQ K +EI AI  +FD P 
Sbjct  1    MSWQTYVDERLMCEIE--GNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL LGG KYMVIQGE GAVIRGKKGPGGV ++KT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 22. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 186.2 bits 703,  Expect = 3e-49
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC IE  GNHL+++AI+G +GS+WAQS+ FPQ+KP+E+  I  +F+ P 
Sbjct  1    MSWQAYVDDHLMCEIE--GNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPG VIRGKKGPGGV +KK+T AL+ GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 23. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 186.2 bits 703,  Expect = 3e-49
 Identities = 99/133 74%, Positives = 115/133 86%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCNIE-DTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
            MSWQAYVD+HLMC +E + G  LT++AI+G DGS+WAQSS FPQ+KP+EI  I K+FD P
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
              LAPTGL+LGG KYMVIQGEP AVIRGKKG GGV IKKT QAL+FG+YDEPV PGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  VVERLGDYLIEQGL 133
            +VERLGDYLI+QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 24. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 186.0 bits 702,  Expect = 3e-49
 Identities = 100/131 76%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHL+C  E+ GNHLTS+AI+G DG++WAQS+NFPQ KP+EI  I  +F  P 
Sbjct  1    MSWQTYVDEHLLC--ENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL+LGG KYMVIQGEP AVIRGKKGPGG+ IKKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQ L
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 25. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 186.0 bits 702,  Expect = 3e-49
 Identities = 100/131 76%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHL+C  E+ GNHLTS+AI+G DG++WAQS+NFPQ KP+EI  I  +F  P 
Sbjct  1    MSWQTYVDEHLLC--ENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL+LGG KYMVIQGEP AVIRGKKGPGG+ IKKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQ L
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 26. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 186.0 bits 702,  Expect = 3e-49
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ+YVD+HLMC++E  GNHLT++AI+G DGS+WAQS+ FPQ+KPQEI+ I K+F+ P 
Sbjct  1    MSWQSYVDDHLMCDVE--GNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGGEKYMVIQGE GAVIRGKKGPGGV IKKT QAL+FG YDEP+  GQCN+V
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIE  L
Sbjct  119  VERLGDYLIESEL 131

Sequence Alignment: 27. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 185.7 bits 701,  Expect = 4e-49
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HL+C IE  GNHLT +AI+G DGS+W QS++FPQ KP+EI AI  +F+ P 
Sbjct  1    MSWQAYVDDHLLCGIE--GNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKGPGGV +KKT  ALI GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 28. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 185.7 bits 701,  Expect = 4e-49
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HL+C+IE  GNHLT +AI+G DGS+WAQS++FPQ KP+EI AI  +F+ P 
Sbjct  1    MSWQAYVDDHLLCDIE--GNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKGPGGV +KKT  ALI GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VER GDYLI+QG
Sbjct  119  VERPGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 185.7 bits 701,  Expect = 4e-49
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+IE  GNHL+S+AI+G DG++WAQS +FPQ+KP+E+ AI K+F+ P 
Sbjct  1    MSWQTYVDDHLMCDIE--GNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGEPG VIRGKKGPGGV IKKT QALI GIY EP+ PGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VER+GDYL+EQG+
Sbjct  119  VERIGDYLVEQGM 131

Sequence Alignment: 30. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 185.2 bits 699,  Expect = 5e-49
 Identities = 100/131 76%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HLTS+AIVG DG++WAQS+ FPQ KP+E+  I K+FD P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLG  KYMVIQGEPGAVIRGKKG GG+ +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 31. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 185.2 bits 699,  Expect = 5e-49
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC+I+  G+HLT++AI+G DGS+WAQSS FP+ KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDDHLMCDID--GHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGE GAVIRGKKG GGV +KKT+QAL+FGIY+EP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 32. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 184.7 bits 697,  Expect = 7e-49
 Identities = 100/131 76%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC+I+  GN LT++AI+G DGS+W+QS+ FP  KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 184.7 bits 697,  Expect = 7e-49
 Identities = 100/131 76%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC IE  GN LTS+AI+G DGS+WAQS+ FPQ KP+EI AI  +F  P 
Sbjct  1    MSWQTYVDDHLMCEIE--GNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGL+LGG KYMVIQGE GAVIRGKKGPGG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQ L
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 34. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 184.7 bits 697,  Expect = 7e-49
 Identities = 99/133 74%, Positives = 113/133 84%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC+I+  G HL ++AI+G DGS+WAQSSNFPQ K +EI  I K+F+ P 
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGL LGG KYMVIQGE GAVIRGKKG GGV IKKT+QAL+FGIY+EPV PGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 35. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 183.9 bits 694,  Expect = 1e-48
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVDEHLMC IE  G HL+++AIVG DGS+WAQS +FP++KP+E+  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCEIE--GQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLF+GG KYMVIQGEPG VIRGKKG GG+ IKKT  +LI G+YDEP+ PGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGF 131

Sequence Alignment: 36. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 183.9 bits 694,  Expect = 1e-48
 Identities = 97/133 72%, Positives = 114/133 85%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+I+  G HL +++IVG DGSIWAQS++FPQ+KP+EI  I K+FD P 
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGL++ G KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 37. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 183.6 bits 693,  Expect = 2e-48
 Identities = 93/133 69%, Positives = 115/133 86%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+IE TG HLT++AI+G+DG++WA+S  FP+ KP+E++ I  EF+   
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMV+QGE GAVIRGKKG GG+CIKKT QA++ GIYDEPVAPGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYL++Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 38. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 183.4 bits 692,  Expect = 2e-48
 Identities = 97/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HL+C+IE  G HL+++AIVG DGS+WAQS NFP++KP+E+  + K+FD P 
Sbjct  1    MSWQAYVDDHLLCDIE--GQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLF+GG KYMVIQGEPG VIRGKKG GG+ IKKT  +LI GIYDEP+ PGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGF 131

Sequence Alignment: 39. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 183.4 bits 692,  Expect = 2e-48
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HL S+AI+G DG++WAQS++FPQ KP+EI  I K+FD P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMVIQGEPGAVIRGKKG GG+ IKKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 40. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 183.1 bits 691,  Expect = 2e-48
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+I+  GN LT++AI+G DGS+W+QS+ FP  KP+EI AI K+FD P 
Sbjct  1    MSWQQYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 183.1 bits 691,  Expect = 2e-48
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+I+  GN LT++AI+G DGS+W+QS+ FP  KP+EI AI K+FD P 
Sbjct  1    MSWQQYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 42. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 182.9 bits 690,  Expect = 3e-48
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ Y DEHLMC IE  GN L ++AI+G DGS+WAQSS FPQ+KP+EI  +  +F+ P 
Sbjct  1    MSWQTYGDEHLMCEIE--GNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGAVIR KKGPGGV +KKT+QALI GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 43. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 182.9 bits 690,  Expect = 3e-48
 Identities = 99/131 75%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC+I+  GN LT++AI+G DGS+W+QS+ FP  KP+EI AI K++D P 
Sbjct  1    MSWQAYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 44. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 182.9 bits 690,  Expect = 3e-48
 Identities = 98/131 74%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HL+S+AIVG DG++WAQS+ FPQ KP+E+  I K+FD P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAP GLFLG  KYMVIQGEPGAVIRGKKG GG+ +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 45. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 182.6 bits 689,  Expect = 3e-48
 Identities = 99/131 75%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVDEHLMC I+  G+HLT++AI+G DGS+WAQSS+FPQ K +EI  I  +F+ P 
Sbjct  1    MSWQAYVDEHLMCEID--GHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LG  KYMVIQGEPGAVIRGKKG GGV +KKT QALIFGIY+EP+ PGQCNMV
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGM 131

Sequence Alignment: 46. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 182.1 bits 687,  Expect = 4e-48
 Identities = 98/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HLTS+AIVG DG+ WAQS+ FP+ KP+E+ AI K+FD P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGL LGG KYMVIQGEPGAVIRGKKG GG+ +KKT Q+LI GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 47. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 182.1 bits 687,  Expect = 4e-48
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC IE  G+HLTS+AI+G DG++WAQS+ FP  KP+E+  I K+FD P 
Sbjct  1    MSWQAYVDDHLMCEIE--GHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLG  KYMVIQGEPGAVIRGKKG GGV +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            +E+LGDYLIEQG+
Sbjct  119  IEKLGDYLIEQGM 131

Sequence Alignment: 48. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 181.6 bits 685,  Expect = 6e-48
 Identities = 96/131 73%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HL S+AI+G DG++WAQS++FPQ KP+EI  I K+FD P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMVIQGEPG VIRGKKG GG+ IKKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 49. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 181.6 bits 685,  Expect = 6e-48
 Identities = 96/131 73%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HL S+AI+G DG++WAQS++FPQ KP+EI  I K+FD P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMVIQGEPG VIRGKKG GG+ IKKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 50. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 181.3 bits 684,  Expect = 7e-48
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+IE  GN LTS+AI+G DGS+WA S++FPQ   +E+ AI K+F+ P 
Sbjct  1    MSWQVYVDDHLMCDIE--GNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGLFLGG KYMVIQGEPGAVIRGKKG GGV +KKT QALI G+YDEP+ PGQCNM+
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 51. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 181.3 bits 684,  Expect = 7e-48
 Identities = 96/133 72%, Positives = 113/133 84%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCNIE-DTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
            MSWQ YVD+HLMC ++ + G +L+++AI+G DGS+WAQSS FP+ KP+EI  I K FD P
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
              LAPTGL+LGG KYMVIQGEP AVIRGKKG GGV IKKT QAL+FG+YDEPV PGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  VVERLGDYLIEQGL 133
            +VERLGDYLIEQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 52. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 180.8 bits 682,  Expect = 1e-47
 Identities = 95/131 72%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+I+  G+ LT++AI+G DGS+WAQSS FPQ K  E+ A+ K+FD P 
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGEPGAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 53. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 180.8 bits 682,  Expect = 1e-47
 Identities = 99/133 74%, Positives = 112/133 84%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC+I+   ++  +SAIVG DGS+WAQSS+FPQ KPQEI  I K+F+ P 
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 54. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 180.6 bits 681,  Expect = 1e-47
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+I+  G+ LT++AI+G DGS+WAQSS+FPQ K  E+ A+ K+FD P 
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGEPGAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLLDQGL 131

Sequence Alignment: 55. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 180.3 bits 680,  Expect = 1e-47
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC+I+  G+ LT++AI+G DGS+WAQSS+FPQ K  E+ AI K+FD P 
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LG  KYMVIQGEPGAVIRGKKG GG+ +KKT+QALI GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 56. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 180.1 bits 679,  Expect = 2e-47
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+ LMC+I+  G+HLT++AI+G DGS+WA+SS FP+ KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDDRLMCDID--GHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL LGG KYMVIQGE GAVIRGKKG GGV +KKT QAL+FGIY+EP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+QGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 57. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 180.1 bits 679,  Expect = 2e-47
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC+I+  GN LT++AI+G DGS+W+QS+ FP  + +EI AI K+FD P 
Sbjct  1    MSWQAYVDDHLMCDID--GNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            TLAPTGLFLGG KYMVIQGE GAVIRGKKG GG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLIEQGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 58. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 179.6 bits 677,  Expect = 3e-47
 Identities = 94/131 71%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC I+  G HL+S+AI+G D ++WAQS NFPQ KP+EI AI  +F+ P 
Sbjct  1    MSWQAYVDDHLMCEID--GQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPG VIRGKKG GG+ +KKT  ALI G+YDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGF 131

Sequence Alignment: 59. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 179.5 bits 677,  Expect = 3e-47
 Identities = 98/133 73%, Positives = 113/133 84%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCNIED-TGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
            MSWQAYVD+HLMC+IE   G+ LT++AIVG DGS+WAQS+ FPQ KP+E+  I  +F+ P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
              LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGL 133
            VVERLGDYL+EQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 60. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 179.3 bits 676,  Expect = 3e-47
 Identities = 98/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HL+C+I+  G  LT++AIVG DGS+WAQS  FPQ KP+EI AI K+FD P 
Sbjct  1    MSWQAYVDDHLLCDID--GQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKG GGV IKKT  ALI GIY+EP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL +QG+
Sbjct  119  VERLGDYLFDQGF 131

Sequence Alignment: 61. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 179.3 bits 676,  Expect = 3e-47
 Identities = 97/133 72%, Positives = 113/133 84%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNH-LTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
            MSWQAYVD+HLMC+IE   +H LT++AIVG DGS+WAQS+ FPQ KP+E+  I  +F+ P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
              LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGL 133
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 62. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 179.0 bits 675,  Expect = 4e-47
 Identities = 95/131 72%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC IE  G+HL S+AI G DG++WAQS++FPQ KP+EI  I K++D P 
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTG+F+   KYMVIQGEPGAVIRGKKG GG+ IKKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 63. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 179.0 bits 675,  Expect = 4e-47
 Identities = 95/131 72%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD HL+C IE  G+HL+S+AI+G DG +WAQSS+FPQ KP+EI AI  +F  P 
Sbjct  1    MSWQTYVDNHLLCEIE--GDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTGL+LGG KYMVIQGEPGA+I GKKGPGGV I+KT QALI GIYD+P+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYLI+ GL
Sbjct  119  VERLGDYLIDTGL 131

Sequence Alignment: 64. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 178.5 bits 673,  Expect = 5e-47
 Identities = 97/130 74%, Positives = 111/130 85%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSW+AYVD+HL C I+  G HLTS+AI+G DGS+WAQS NFPQ KP+EI  I K+F+ P 
Sbjct  1    MSWKAYVDDHLCCEID--GQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT  ALI+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 65. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 178.3 bits 672,  Expect = 6e-47
 Identities = 97/133 72%, Positives = 112/133 84%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCNIED-TGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
            MSWQAYVD+HLMC+IE   G+ LT++AIVG DGS+WAQS+ FPQ KP+E+  I  +F+ P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
              LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGL 133
            V ERLGDYL+EQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 66. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 177.2 bits 668,  Expect = 1e-46
 Identities = 96/130 73%, Positives = 111/130 85%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HL C I+  G HLTS+AI+G DGS+WA+S NFP+ KP+EI  I K+F+ P 
Sbjct  1    MSWQAYVDDHLCCEID--GQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT  ALI+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 67. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 176.7 bits 666,  Expect = 2e-46
 Identities = 95/131 72%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVDEHLMC IE  G+HL ++AIVG DG+ WAQS+ FP+ K +++  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCEIE--GHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLG  KYMVIQGEPGAVIRGKKG GG+ +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 68. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 176.7 bits 666,  Expect = 2e-46
 Identities = 95/131 72%, Positives = 108/131 82%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HL C I+  G HLTS+AI+G DG +W QS NFPQ KP+EI  I K+FD P 
Sbjct  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT   LI+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGF 131

Sequence Alignment: 69. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 176.7 bits 666,  Expect = 2e-46
 Identities = 96/133 72%, Positives = 112/133 84%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCNIEDTGNH-LTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
            MSWQAYVD+HLMC+IE   +H LT++AIVG DGS+WAQS+ FPQ KP+EI  I  +F+ P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
             TLAPTGL LGG KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGL 133
            VV RLGD L++QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 70. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 175.0 bits 659,  Expect = 6e-46
 Identities = 93/132 70%, Positives = 111/132 84%, Gaps = 1/132 0%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC++ D GN   S+AI+G DGS+WAQS+NFPQ+KP+E+  I  +F+   
Sbjct  1    MSWQAYVDDHLMCDVGD-GNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGE GAVIRGKKG GG  +KKT QA++ GIYDEP+ PGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQGL
Sbjct  120  VERLGDYLLEQGL 132

Sequence Alignment: 71. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 174.7 bits 658,  Expect = 8e-46
 Identities = 94/130 72%, Positives = 109/130 83%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HL C I+  G HLTS+AI+G DGS+W +S NFP+ KP+EI  I K+F+ P 
Sbjct  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT  ALI+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 72. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 174.2 bits 656,  Expect = 1e-45
 Identities = 95/130 73%, Positives = 110/130 84%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSW+AYVD+HL C I+  G +LTS+AI+G DGS+WAQS NFPQ KP+E   I K+F+ P 
Sbjct  1    MSWKAYVDDHLCCEID--GQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT  ALI+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 73. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 173.7 bits 654,  Expect = 1e-45
 Identities = 92/130 70%, Positives = 112/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVDEHLMC+++  G+ LTS+AI+G DGS+WAQS+ FP++KP EI AI  +F+ P 
Sbjct  1    MSWQTYVDEHLMCDMD--GHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMVIQGEPG VIRGKKG GGV IKK+  ALIFG+YDEP+ PGQCN+V
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 74. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 171.6 bits 646,  Expect = 6e-45
 Identities = 92/131 70%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQAYVD+HLMC++ D GN L S+AI+G DGS+WAQS+NFPQ+KP+E+  I  +F+   
Sbjct  1    MSWQAYVDDHLMCDVGD-GNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
             LAPTGLFLGG KYMVIQGE GAVI GKKG GG  +KKT QA++ GIYDEP+ PGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGL 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 152.8 bits 572,  Expect = 2e-39
 Identities = 84/109 77%, Positives = 94/109 86%, Gaps = 2/109 1%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
            MSWQ YVD+HLMC IE  GN+LTS+AI+G DGSIWAQS++FPQ KP+EI AI  +F  P 
Sbjct  1    MSWQTYVDDHLMCEIE--GNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEP 111
            TLAPTGL+LGG KYMVIQGE GAVIRGKKGPGGV +KKT QALI GIYDEP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 127.3 bits 473,  Expect = 2e-31
 Identities = 96/130 73%, Positives = 112/130 86%, Gaps = 30/130 23%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQ----------------- 43
            MSWQ YVD+HLMC++E  G+HL S+AI+G DGS+WAQS  FP+                 
Sbjct  1    MSWQTYVDDHLMCDLE--GHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------VKPQEIEAINKEFDGPNTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPG 92
                        KP+EI  I K+FD P  LAPTGLFLGG KYMVIQGEPGAVIRGKKG  
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GVCIKKTTQALIFGIYDEPVAPGQCNMVVERLGDYLIEQG 132
            G+ IKKT QALIFGIY+EPV PGQCNMVVE++GDYL++QG
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 79.6 bits 286,  Expect = 3e-17
 Identities = 51/122 41%, Positives = 77/122 63%, Gaps = 10/122 8%
Query  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGV-DGSIWAQ-SSNFP-QVKPQEIEAINKEF- 56
            MSWQ+YVD ++ C   D       + I G+ DG++WA+   ++P Q+  QE++ I     
Sbjct  1    MSWQSYVDNQI-CQHVDC----RLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  57   DGPNTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQ 116
              PN++   G+ LGGEKY+ IQ +  +++RG+KG   +CI  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  117  CNMVVERLGDYL 128
             N VVE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.