The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG
HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
VERLGDYLIEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
O49894 Mer a 1 133 907 233.6 1.4e-63
XP030492464 Can s 2.0101 133 819 211.6 5.7e-57
QVU02258 Que ac 2.0101 133 818 211.4 6.8e-57
P25816 Bet v 2 133 803 207.6 9.1e-56
O24169 Ole e 2 134 803 207.6 9.2e-56
O24170 Ole e 2 134 800 206.9 1.5e-55
AAL76933 Dau c 4 134 799 206.6 1.8e-55
O24171 Ole e 2 134 795 205.6 3.7e-55
O24650 Phl p 12.0102 131 789 204.1 1e-54
A0A2I4DNN6 Jug r 7.0101 131 785 203.1 2e-54
Q9XF37 Api g 4 134 784 202.9 2.5e-54
P35079 Phl p 12.0101 131 782 202.4 3.4e-54
CAA54686 Phl p 12.0101 131 782 202.4 3.4e-54
Q9M7N0 Hev b 8.0201 131 780 201.9 4.8e-54
Q9XF38 Pyr c 4 131 776 200.9 9.5e-54
O24282 Phl p 12.0103 131 772 199.9 1.9e-53
Q9XF40 Mal d 4 131 768 198.9 3.8e-53
QRN65366 Lig v 2.0101 134 764 197.9 7.8e-53
Q9FUD1 Ory s 12.0101 131 756 195.9 3e-52
Q9M7M8 Hev b 8.0203 131 755 195.7 3.6e-52
Q8L5D8 Pho d 2.0101 131 754 195.4 4.3e-52
Q9FR39 Zea m 12.0105 131 754 195.4 4.3e-52
AAL07320 Lit c 1 131 753 195.2 5.1e-52
Q9LEI8 Hev b 8.0204 131 752 194.9 6e-52
O22655 Zea m 12.0104 131 752 194.9 6e-52
A0A0A0REA1 Koc s 2.0101 133 750 194.4 8.7e-52
Q9XG85 Par j 3 132 746 193.4 1.7e-51
Q9M7M9 Hev b 8.0202 131 745 193.2 2e-51
P35081 Zea m 12.0101 131 745 193.2 2e-51
A0A023W2L7 Pro j 2.0101 133 744 192.9 2.5e-51
P52184 Hor v 12.0101 131 743 192.7 2.9e-51
O04725 Cyn d 12 131 743 192.7 2.9e-51
CAD37202 Pru p 4.0201 131 743 192.7 2.9e-51
O81982 Hel a 2 133 743 192.7 2.9e-51
AAL92870 Che a 2 131 742 192.4 3.4e-51
P35083 Zea m 12.0103 131 741 192.2 4e-51
AAL29690 Lyc e 1 131 741 192.2 4e-51
ACS34771 Sal k 4.0101 133 741 192.2 4.1e-51
FM164277 Tri a 12.0104 131 740 191.9 4.8e-51
Q9XF41 Mal d 4 131 740 191.9 4.8e-51
Q9T0M8 Par j 3 131 739 191.7 5.7e-51
AJ421030 Art v 4.0101 133 738 191.4 6.9e-51
AF377948 Mus a 1.0101 131 737 191.2 8.1e-51
P35082 Zea m 12.0102 131 737 191.2 8.1e-51
Q9AXH4 Cor a 2 131 736 190.9 9.6e-51
P49232 Tri a 12.0101 138 735 190.6 1.2e-50
P49233 Tri a 12.0102 141 735 190.6 1.3e-50
ABU95412 Sin a 4.0101 131 734 190.4 1.4e-50
CAD37201 Pru p 4.0101 131 734 190.4 1.4e-50
Q9STB6 Hev b 8.0102 131 733 190.2 1.6e-50
Q9XF42 Mal d 4 131 733 190.2 1.6e-50
AY081852 Pru du 4.0102 131 733 190.2 1.6e-50
AY081850 Pru du 4.0101 131 733 190.2 1.6e-50
A0A0A0RCW1 Aca f 2 133 733 190.2 1.6e-50
ACP43298 Ama r 2.0101 133 733 190.2 1.6e-50
AAK01235 Cor a 2 131 730 189.4 2.7e-50
Q5XWE1 Citr l 2.0101 131 727 188.7 4.6e-50
Q9XF39 Pru av 4 131 727 188.7 4.6e-50
CAD10376 Cap a 2 131 725 188.2 6.4e-50
P49234 Tri a 12.0103 140 723 187.6 1e-49
QID21357 Pop n 2.0101 131 718 186.4 2.2e-49
AAP13533 Cuc m 2 131 717 186.2 2.6e-49
O65809 Gly m 3 131 717 186.2 2.6e-49
O65812 Hev b 8.0101 131 716 185.9 3.1e-49
AAK54835 Ana c 1 131 713 185.2 5.1e-49
Q5EF31 Cro s 1.0101 131 713 185.2 5.1e-49
AJ421031 Art v 4.0201 133 713 185.2 5.2e-49
P84177 Cit s 2.0101 131 711 184.7 7.3e-49
O65810 Gly m 3 131 710 184.4 8.6e-49
Q42449 Ara t 8 131 708 183.9 1.2e-48
Q93YG7 Sola l 1.0101 131 703 182.7 2.9e-48
CAD10377 Lyc e 1 131 703 182.7 2.9e-48
ADK22841 Sal k 4.0201 133 694 180.4 1.4e-47
Q9SQI9 Ara h 5 131 685 178.2 6.5e-47
FG438715 Act d 9.0101 109 597 156.3 2.1e-40
QEQ43417 Sola m 1.0101 159 530 139.4 3.7e-35
A0A1B2YLJ4 Tyr p 36.0101 131 248 69.1 4.4e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 233.6 bits 907,  Expect = 1e-63
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 2. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 211.6 bits 819,  Expect = 6e-57
 Identities = 114/133 85%, Positives = 128/133 96%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMCDIDGQGQHL AA+I+GHDGSIWAQS+SFPQLK +EIT I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL+++GTKYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 3. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 211.4 bits 818,  Expect = 7e-57
 Identities = 113/133 84%, Positives = 129/133 96%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMCDIDGQGQHLAAA+I+GHDGS+WAQS++FPQ+K EEI+ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ GTKYMVIQGE+GAVIRGKKGSGG+TIKKT QALVFGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 4. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 207.6 bits 803,  Expect = 9e-56
 Identities = 113/133 84%, Positives = 127/133 95%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMCDIDGQ  +  A++IVGHDGS+WAQS+SFPQ+KP+EITGIMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ G KYMVIQGE+GAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 5. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 207.6 bits 803,  Expect = 9e-56
 Identities = 114/133 85%, Positives = 126/133 94%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQH-LAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
            MSWQ YVDDHLMCDI+G+  H L AA+IVGHDGS+WAQSA+FPQ+KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
            GHLAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGM 133
            VVERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 6. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 206.9 bits 800,  Expect = 2e-55
 Identities = 113/133 84%, Positives = 127/133 95%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIDG-QGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
            MSWQ YVDDHLMCDI+G +G+ L AA+IVGHDGS+WAQSA+FPQ+KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
            GHLAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGM 133
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 7. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 206.6 bits 799,  Expect = 2e-55
 Identities = 110/133 82%, Positives = 129/133 96%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIDGQ-GQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
            MSWQTYVDDHLMC++DG  GQ+L+AA+I+GHDGS+WAQS++FP++KPEEITGIMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
            GHLAPTGLY+ GTKYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  VVERLGDYLIEQGM 133
            +VERLGDYLIEQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 8. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 205.6 bits 795,  Expect = 4e-55
 Identities = 112/133 84%, Positives = 126/133 94%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIDG-QGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
            MSWQ YVDDHLMCDI+G +G+ L AA+IVGHDGS+WAQSA+FPQ+KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
            GHLAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGM 133
            V ERLGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 9. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 204.1 bits 789,  Expect = 1e-54
 Identities = 110/131 83%, Positives = 127/131 96%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HLA+A+I+GHDG++WAQSA FPQ+KPEEITGIMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTG+++AG KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 10. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 203.1 bits 785,  Expect = 2e-54
 Identities = 108/131 82%, Positives = 126/131 96%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+IDGQ  HL AA+I+GHDGS+WAQS+SFPQ+KPEEI  IMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIDGQ--HLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKG+GGIT+KKTGQAL+FGIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 11. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 202.9 bits 784,  Expect = 2e-54
 Identities = 107/133 80%, Positives = 124/133 93%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIDGQ-GQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
            MSWQ YVDDHLMC+++G  GQ L AA+I+GHDGS+WAQS++FPQ+KPEEI GIMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
            GHLAPTGLY+ G KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  VVERLGDYLIEQGM 133
            +VERLGDYLI+QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 12. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 202.4 bits 782,  Expect = 3e-54
 Identities = 109/131 83%, Positives = 126/131 96%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HLA+A+I+GHDG++WAQSA FPQ+KPEEITGIMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTG+++AG KYMVIQGE G VIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 13. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 202.4 bits 782,  Expect = 3e-54
 Identities = 109/131 83%, Positives = 126/131 96%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HLA+A+I+GHDG++WAQSA FPQ+KPEEITGIMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTG+++AG KYMVIQGE G VIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 14. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 201.9 bits 780,  Expect = 5e-54
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMCDIDG+  HL AA+I+GHDGS+WAQS+SFPQ+KPEE+  IMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDGH--HLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGGIT+KKTGQAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 15. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 200.9 bits 776,  Expect = 1e-53
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG+  HL AA+I+GHDGS+WAQS++FP++KPEEIT IMKDFDEPG
Sbjct  1    MSWQAYVDDHLMCDIDGH--HLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGG+T+KKT QALVFGIYEEP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 16. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 199.9 bits 772,  Expect = 2e-53
 Identities = 108/131 82%, Positives = 125/131 95%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HLA+A+I GHDG++WAQSA FPQ+KPEEITGIMKD+DEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTG+++A  KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 17. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 198.9 bits 768,  Expect = 4e-53
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDD LMCDIDG+  HL AA+I+GHDGS+WA+S++FP++KPEEIT IMKDFDEPG
Sbjct  1    MSWQAYVDDRLMCDIDGH--HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGG+T+KKTGQALVFGIYEEP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 18. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 197.9 bits 764,  Expect = 8e-53
 Identities = 110/133 82%, Positives = 122/133 91%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQH-LAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
            MSWQ YVDDHLMCDI+G+  H L AA+IVGHDGS+WAQSA+FPQ+KPEEI GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
            G LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGITIKKT QALVFGIYEEPVTPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLIEQGM 133
            VV RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 19. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 195.9 bits 756,  Expect = 3e-52
 Identities = 106/131 80%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HL +A+IVGHDG++WAQSA+FPQ+KPEE+T IMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++  TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 20. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 195.7 bits 755,  Expect = 4e-52
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDIDG+   L AA+I+GHDGS+WAQS+ FPQ+K +E+  +MKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGGIT+KKTGQAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 21. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 195.4 bits 754,  Expect = 4e-52
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVD+HLMC+IDG+  HL AA+I+GHDGS+WAQS+SFPQ+K EEIT IM DF+EPG
Sbjct  1    MSWQAYVDEHLMCEIDGH--HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+  TKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+FGIYEEP+TPGQCNMV
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQGM
Sbjct  119  VERLGDYLIEQGM 131

Sequence Alignment: 22. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 195.4 bits 754,  Expect = 4e-52
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHL+CDI+GQ  HL+AA+IVGHDGS+WAQS +FP+LKPEE+ G++KDFDEPG
Sbjct  1    MSWQAYVDDHLLCDIEGQ--HLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ GIY+EP+TPGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 23. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 195.2 bits 753,  Expect = 5e-52
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMC+ DGQ  HL AA+I+GHDGS+WAQSA+FPQ+KP EI  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCETDGQ--HLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLVDQGL 131

Sequence Alignment: 24. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 194.9 bits 752,  Expect = 6e-52
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDIDG+   L AA+I+GHDGS+WAQS+SFPQ+K +E+  +MKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGGIT+KKTGQAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLDQGL 131

Sequence Alignment: 25. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 194.9 bits 752,  Expect = 6e-52
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVD+HLMC+I+GQ  HL+AA+IVGHDGS+WAQS SFP+LKPEE+ GI+KDFDEPG
Sbjct  1    MSWQAYVDEHLMCEIEGQ--HLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 26. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 194.4 bits 750,  Expect = 9e-52
 Identities = 103/133 77%, Positives = 120/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDI+G   HL  A+I+G DGS+WAQSA+FPQ+KP+EI  I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+G VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 27. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 193.4 bits 746,  Expect = 2e-51
 Identities = 104/132 78%, Positives = 121/132 91%, Gaps = 1/132 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCD+ G G   A+A+I+GHDGS+WAQSA+FPQLKPEE+TGIM DF+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGESGAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQG+
Sbjct  120  VERLGDYLLEQGL 132

Sequence Alignment: 28. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 193.2 bits 745,  Expect = 2e-51
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDIDG+   L AA+I+GHDGS+WAQS+SFPQ+K +E+  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++  TKYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 29. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 193.2 bits 745,  Expect = 2e-51
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HL +A+IVGHDG+ WAQS +FP++KPEE+  IMKDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL + GTKYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 30. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 192.9 bits 744,  Expect = 2e-51
 Identities = 102/133 76%, Positives = 120/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMC+I+G   HL+AA+I+G DGS+WAQSASFPQ+KP+EI+ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE G VIRGKKG GGI +KKTGQAL+ GIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 31. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 192.7 bits 743,  Expect = 3e-51
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHL C+IDGQ  HL +A+I+GHDG +W QS +FPQ+KPEEI GI+KDFDEPG
Sbjct  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 32. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 192.7 bits 743,  Expect = 3e-51
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+I+G+  HL +A+I+GHDG++WAQSA+FP +KPEE+  IMKDFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGH--HLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++  TKYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            +E+LGDYLIEQGM
Sbjct  119  IEKLGDYLIEQGM 131

Sequence Alignment: 33. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 192.7 bits 743,  Expect = 3e-51
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+I+G   HL+AA+I+GHDGS+WAQSA+FPQLKPEE+TGI+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GAVIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 34. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 192.7 bits 743,  Expect = 3e-51
 Identities = 101/133 75%, Positives = 120/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVD+HLMCDI+G GQHL +A+I+G DG++WAQSA FPQ+KPEE+ GI+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTG++IAG KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 35. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 192.4 bits 742,  Expect = 3e-51
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDI+G   HL++A+I+GHDG++WAQS SFPQLKPEE++ IMKDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VER+GDYL+EQGM
Sbjct  119  VERIGDYLVEQGM 131

Sequence Alignment: 36. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 192.2 bits 741,  Expect = 4e-51
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMC+I+G+  HL++A+IVGHDG++WAQS +FPQ+KPEE+T I+KDFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAP GL++  TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 37. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 192.2 bits 741,  Expect = 4e-51
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDI+G   HL +A+I+G+DGS+WAQSA+FPQ+KPEEIT IM DF EPG
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKG+GGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDY+IEQG+
Sbjct  119  VERLGDYIIEQGL 131

Sequence Alignment: 38. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 192.2 bits 741,  Expect = 4e-51
 Identities = 101/133 75%, Positives = 121/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMC+I+G   HL AA+I+G DGS+WAQSA+FPQ+KP+EI+ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+G VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 39. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 191.9 bits 740,  Expect = 5e-51
 Identities = 102/130 78%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSW+ YVDDHL C+IDGQ  HL +A+I+GHDGS+WAQS +FPQ+KPEEI GI+KDF+EPG
Sbjct  1    MSWKAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 191.9 bits 740,  Expect = 5e-51
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+I+G   HL+AA+I+GH+GS+WAQSA+FPQLKPEE+TGIM DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 191.7 bits 739,  Expect = 6e-51
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCD+ G G  LA+A+I+GHDGS+WAQSA+FPQLKPEE+TGIM DF+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGESGAVI GKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 42. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 191.4 bits 738,  Expect = 7e-51
 Identities = 101/133 75%, Positives = 121/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDI+G GQHL +A+I G DG++WA+SASFP++KP EI  I+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            +LAPTGL++ G KYMVIQGE+GAVIRGKKG+GGI IKKTGQA+VFGIY+EPV PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL++QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 43. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 191.2 bits 737,  Expect = 8e-51
 Identities = 106/130 81%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHL+CDIDGQ   L AA+IVGHDGS+WAQS +FPQ KPEEI  IMKDFDEPG
Sbjct  1    MSWQAYVDDHLLCDIDGQ--CLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GAVIRGKKGSGG+TIKKT  AL+ GIY EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL +QG
Sbjct  119  VERLGDYLFDQG 130

Sequence Alignment: 44. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 191.2 bits 737,  Expect = 8e-51
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVD+HLMC+I+G+  HLAAA+IVGHDG+ WAQS +FP++K E++  IMKDFDEPG
Sbjct  1    MSWQAYVDEHLMCEIEGH--HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++  TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 45. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 190.9 bits 736,  Expect = 1e-50
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ Y D+HLMC+I+G    LAAA+I+GHDGS+WAQS++FPQLKPEEITG+M DF+EPG
Sbjct  1    MSWQAYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GAVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 46. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 190.6 bits 735,  Expect = 1e-50
 Identities = 101/130 77%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHL C+IDGQ  HL +A+I+GHDGS+W +S +FP++KPEEI GI+KDF+EPG
Sbjct  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 47. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 190.6 bits 735,  Expect = 1e-50
 Identities = 101/130 77%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHL C+IDGQ  HL +A+I+GHDGS+WA+S +FP++KPEEI GI+KDF+EPG
Sbjct  1    MSWQAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 48. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 190.4 bits 734,  Expect = 1e-50
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCD++G    L AA+I+G+DGS+WAQSA+FPQLKPEEI GI  DF EPG
Sbjct  1    MSWQTYVDDHLMCDVEGN--RLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL+I GTKYMVIQGE  AVIRGKKG+GG+TIKKT QA+VFGIYEEP+TPGQCNMV
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 49. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 190.4 bits 734,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSA+FP +KPEEI  I+KDFD+PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 50. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+I+G   HL+AA+I+G+DGS+WAQSA+FPQ+K EEITGIM DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLYI GTKYMVIQGE GAVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 51. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSASFP +KPEEI  I+KDFD+PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGGITIKKT QAL+ GIY+EPVTPGQCN+V
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 52. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSA+FP +KPEEI  I+KDFD+PG
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSA+FP +KPEEI  I+KDFD+PG
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 54. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 101/133 75%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            M WQTYVDDHLMC+I+G   HL+ A+I+G DGS+WAQSASFPQ+KP+EI  ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE G  IRGKKG GGI +KKTGQALVFGIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 102/132 77%, Positives = 117/132 88%, Gaps = 0/132 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+I+G   HL  A+I+G DGS+WAQSA FPQ+KP+EI  I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 56. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 189.4 bits 730,  Expect = 3e-50
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTY D+HLMC+I+G    LAAA+I+GHDGS+WAQS++FPQLKPEEITG+M DF+EPG
Sbjct  1    MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GAVIR KKG GG+T+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 57. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 188.7 bits 727,  Expect = 5e-50
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+I+G   HL +A+I+G+DGS+WA+S +FPQLKPEEITGI+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLYI G+KYMVIQGE GAVIRGKKG GG+T+KKT  ALV GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 58. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 188.7 bits 727,  Expect = 5e-50
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSA+FP +KPEEI  I+KD+D+PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 59. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 188.2 bits 725,  Expect = 6e-50
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMC+I+G    L +A+I+G+DGS+WAQSA+FPQ+KPEEIT IM DF EPG
Sbjct  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE+GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 60. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 187.6 bits 723,  Expect = 1e-49
 Identities = 100/130 76%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSW+ YVDDHL C+IDGQ  +L +A+I+GHDGS+WAQS +FPQ+KPEE  GI+KDF+EPG
Sbjct  1    MSWKAYVDDHLCCEIDGQ--NLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 61. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 186.4 bits 718,  Expect = 2e-49
 Identities = 98/131 74%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDI+G    L +A+I+GHDGS+WA SASFPQ+  EE++ IMKDF+EPG
Sbjct  1    MSWQVYVDDHLMCDIEGN--TLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKGSGG+T+KKT QAL+ G+Y+EP+TPGQCNM+
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 62. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 186.2 bits 717,  Expect = 3e-49
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVD+HLMC+I+G   HL +A+I+G+DGS+WAQS +FPQLKPEE+ GI+ DF +PG
Sbjct  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLYI GTKYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 63. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 186.2 bits 717,  Expect = 3e-49
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHL+CDI+G   HL  A+I+G+DGS+WAQS  FPQ+KPEEIT IM DF+EPG
Sbjct  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VER GDYLI+QG
Sbjct  119  VERPGDYLIDQG 130

Sequence Alignment: 64. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 185.9 bits 716,  Expect = 3e-49
 Identities = 99/131 75%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+ LMC+I+G   HL AA+I+G+DGS+WAQS++FPQ+K EEIT IM DFDEPG
Sbjct  1    MSWQTYVDERLMCEIEGN--HLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKG GG+T++KT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 65. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 185.2 bits 713,  Expect = 5e-49
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMC+IDGQ  HL++A+I+GHD ++WAQS +FPQ+KPEEI+ I+ DF+ PG
Sbjct  1    MSWQAYVDDHLMCEIDGQ--HLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE G VIRGKKG+GGIT+KKT  AL+ G+Y+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 66. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 185.2 bits 713,  Expect = 5e-49
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HLMCD+DG+   L +A+I+GHDGS+WAQSA FP+LKP EIT I+ DF+EPG
Sbjct  1    MSWQTYVDEHLMCDMDGH--VLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTG+YI G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+V
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 67. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 185.2 bits 713,  Expect = 5e-49
 Identities = 96/133 72%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMCDI+G GQHL AA+I+G DG++WA+S  FP++KPEE+ GI+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ G KYMV+QGE+GAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 68. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 184.7 bits 711,  Expect = 7e-49
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHLMCDIDG    L AA+I+G+DGS+W+QSA+FP ++ EEI  I+KDFD+PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGE+GAVIRGKKGSGGI +KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 69. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 184.4 bits 710,  Expect = 9e-49
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVDDHL+C I+G   HL  A+I+G+DGS+W QS  FPQ+KPEEIT IM DF+EPG
Sbjct  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 70. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 183.9 bits 708,  Expect = 1e-48
 Identities = 100/128 78%, Positives = 115/128 89%, Gaps = 2/128 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ+YVDDHLMCD++G   HL AA+I+G+DGS+WAQSA FPQLKP+EI GI KDF+EPG
Sbjct  1    MSWQSYVDDHLMCDVEGN--HLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ G KYMVIQGE GAVIRGKKG GG+TIKKT QALVFG Y+EP+T GQCN+V
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLIE 130
            VERLGDYLIE
Sbjct  119  VERLGDYLIE 128

Sequence Alignment: 71. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 182.7 bits 703,  Expect = 3e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HL+C+   +G HL +A+I+G+DG++WAQSA+FPQ+KPEEITGIM DF  PG
Sbjct  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 72. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 182.7 bits 703,  Expect = 3e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HL+C+   +G HL +A+I+G+DG++WAQSA+FPQ+KPEEITGIM DF  PG
Sbjct  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 180.4 bits 694,  Expect = 1e-47
 Identities = 97/133 72%, Positives = 114/133 85%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQ YVD+HLMC+I+  G HL +++IVG DGSIWAQS++FPQ+KP+EI  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGL++ G KYMVIQGE GAVIRGKKG GG+ IKKT QAL+FGIY+EPV PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQGM 133
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 74. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 178.2 bits 685,  Expect = 7e-47
 Identities = 94/131 71%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVD+HL+C+I+G   HL++A+I+G+DG +WAQS+ FPQ+KPEEIT IM DF EPG
Sbjct  1    MSWQTYVDNHLLCEIEGD--HLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
             LAPTGLY+ GTKYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLIEQGM 133
            VERLGDYLI+ G+
Sbjct  119  VERLGDYLIDTGL 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 156.3 bits 597,  Expect = 2e-40
 Identities = 85/109 77%, Positives = 99/109 90%, Gaps = 2/109 1%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
            MSWQTYVDDHLMC+I+G   +L +A+I+G+DGSIWAQSASFPQ+KPEEIT IM DF EPG
Sbjct  1    MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEP 111
             LAPTGLY+ GTKYMVIQGE+GAVIRGKKG GG+T+KKT QAL+ GIY+EP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 139.4 bits 530,  Expect = 4e-35
 Identities = 106/130 81%, Positives = 123/130 94%, Gaps = 30/130 23%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQ----------------- 43
            MSWQTYVDDHLMCD++G+  HLA+A+I+G DGS+WAQS +FP+                 
Sbjct  1    MSWQTYVDDHLMCDLEGH--HLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------LKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSG 92
                       +KPEEIT IMKDFDEPG LAPTGL++ GTKYMVIQGE GAVIRGKKGS 
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQG 132
            GITIKKTGQAL+FGIYEEPVTPGQCNMVVE++GDYL++QG
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 69.1 bits 248,  Expect = 4e-14
 Identities = 46/122 37%, Positives = 75/122 61%, Gaps = 10/122 8%
Query  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVG-HDGSIWAQ-SASFP-QLKPEEITGIMKDF- 56
            MSWQ+YVD+++   +D +      A I G +DG++WA+    +P Q+  +E+  I     
Sbjct  1    MSWQSYVDNQICQHVDCR-----LAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  57   DEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQ 116
              P  +   G+++ G KY+ IQ ++ +++RG+KGS  + I  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQADN-SLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  117  CNMVVERLGDYL 128
             N VVE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.