The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL
APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE
RIGDYLVEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL92870 Che a 2 131 904 241.5 5.5e-66
Q9M7N0 Hev b 8.0201 131 800 214.5 7.5e-58
AAL07320 Lit c 1 131 793 212.7 2.7e-57
CAD37202 Pru p 4.0201 131 793 212.7 2.7e-57
AAL29690 Lyc e 1 131 791 212.2 3.8e-57
Q9XF41 Mal d 4 131 791 212.2 3.8e-57
O65809 Gly m 3 131 778 208.8 4e-56
Q9AXH4 Cor a 2 131 777 208.5 4.7e-56
A0A023W2L7 Pro j 2.0101 133 777 208.5 4.8e-56
A0A2I4DNN6 Jug r 7.0101 131 776 208.3 5.7e-56
AAK54835 Ana c 1 131 776 208.3 5.7e-56
Q9M7M8 Hev b 8.0203 131 775 208.0 6.8e-56
Q9M7M9 Hev b 8.0202 131 774 207.7 8.1e-56
CAD10376 Cap a 2 131 774 207.7 8.1e-56
Q9STB6 Hev b 8.0102 131 773 207.5 9.7e-56
Q9XF38 Pyr c 4 131 773 207.5 9.7e-56
Q5XWE1 Citr l 2.0101 131 772 207.2 1.2e-55
Q9LEI8 Hev b 8.0204 131 772 207.2 1.2e-55
AAK01235 Cor a 2 131 771 207.0 1.4e-55
O65812 Hev b 8.0101 131 770 206.7 1.7e-55
CAA54686 Phl p 12.0101 131 769 206.4 2e-55
QID21357 Pop n 2.0101 131 769 206.4 2e-55
O24650 Phl p 12.0102 131 769 206.4 2e-55
P35079 Phl p 12.0101 131 769 206.4 2e-55
Q8L5D8 Pho d 2.0101 131 767 205.9 2.9e-55
O65810 Gly m 3 131 767 205.9 2.9e-55
Q9FUD1 Ory s 12.0101 131 765 205.4 4.1e-55
AF377948 Mus a 1.0101 131 759 203.8 1.2e-54
Q9SQI9 Ara h 5 131 759 203.8 1.2e-54
A0A0A0REA1 Koc s 2.0101 133 759 203.8 1.2e-54
P35081 Zea m 12.0101 131 758 203.6 1.5e-54
O04725 Cyn d 12 131 758 203.6 1.5e-54
AAP13533 Cuc m 2 131 757 203.3 1.7e-54
Q9XF40 Mal d 4 131 756 203.1 2.1e-54
CAD10377 Lyc e 1 131 755 202.8 2.5e-54
Q93YG7 Sola l 1.0101 131 755 202.8 2.5e-54
Q9FR39 Zea m 12.0105 131 755 202.8 2.5e-54
P35083 Zea m 12.0103 131 753 202.3 3.6e-54
O22655 Zea m 12.0104 131 753 202.3 3.6e-54
A0A0A0RCW1 Aca f 2 133 752 202.0 4.4e-54
O24282 Phl p 12.0103 131 750 201.5 6.1e-54
P52184 Hor v 12.0101 131 749 201.2 7.4e-54
Q9XF42 Mal d 4 131 748 201.0 8.8e-54
CAD37201 Pru p 4.0101 131 748 201.0 8.8e-54
AY081850 Pru du 4.0101 131 747 200.7 1.1e-53
AY081852 Pru du 4.0102 131 747 200.7 1.1e-53
ACS34771 Sal k 4.0101 133 746 200.5 1.3e-53
FM164277 Tri a 12.0104 131 745 200.2 1.5e-53
O24169 Ole e 2 134 744 199.9 1.9e-53
ABU95412 Sin a 4.0101 131 743 199.7 2.2e-53
O49894 Mer a 1 133 742 199.4 2.6e-53
Q9XF39 Pru av 4 131 741 199.2 3.1e-53
ACP43298 Ama r 2.0101 133 740 198.9 3.8e-53
P49232 Tri a 12.0101 138 740 198.9 3.9e-53
P49233 Tri a 12.0102 141 740 198.9 4e-53
QVU02258 Que ac 2.0101 133 736 197.9 7.8e-53
O24170 Ole e 2 134 735 197.6 9.4e-53
QRN65366 Lig v 2.0101 134 735 197.6 9.4e-53
Q5EF31 Cro s 1.0101 131 732 196.8 1.6e-52
XP030492464 Can s 2.0101 133 732 196.8 1.6e-52
O24171 Ole e 2 134 730 196.3 2.3e-52
P49234 Tri a 12.0103 140 729 196.0 2.9e-52
P35082 Zea m 12.0102 131 726 195.3 4.6e-52
Q42449 Ara t 8 131 726 195.3 4.6e-52
AAL76933 Dau c 4 134 726 195.3 4.8e-52
P84177 Cit s 2.0101 131 725 195.0 5.6e-52
Q9XF37 Api g 4 134 723 194.5 8.2e-52
Q9XG85 Par j 3 132 717 192.9 2.4e-51
P25816 Bet v 2 133 717 192.9 2.4e-51
Q9T0M8 Par j 3 131 710 191.1 8.3e-51
ADK22841 Sal k 4.0201 133 701 188.8 4.3e-50
AJ421030 Art v 4.0101 133 699 188.2 6.1e-50
O81982 Hel a 2 133 693 186.7 1.8e-49
AJ421031 Art v 4.0201 133 679 183.0 2.2e-48
FG438715 Act d 9.0101 109 644 174.0 9.8e-46
QEQ43417 Sola m 1.0101 159 497 135.7 4.8e-34
A0A1B2YLJ4 Tyr p 36.0101 131 276 78.3 7.5e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 241.5 bits 904,  Expect = 5e-66
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            RIGDYLVEQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 2. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 214.5 bits 800,  Expect = 8e-58
 Identities = 110/131 83%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMCDI+G+HL++AAI+GHDG+VWAQS SFPQ+KPEEV+AIMKDF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPG VIRGKKG GG+T+KKT QALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 3. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 212.7 bits 793,  Expect = 3e-57
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMC+ +G HL++AAI+GHDG+VWAQS +FPQ+KP E++AIMKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPG VIRGKKGPGG+T+KKT QALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLV+QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 4. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 212.7 bits 793,  Expect = 3e-57
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMC+IEGNHLS+AAI+GHDG+VWAQS +FPQLKPEEV+ I+ DFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KK+  AL+IGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 5. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 212.2 bits 791,  Expect = 4e-57
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMCDIEGNHL+SAAI+G+DG+VWAQS +FPQ+KPEE++AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE G VIRGKKG GG+T+KKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 6. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 212.2 bits 791,  Expect = 4e-57
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMC+IEGNHLS+AAI+GH+G+VWAQS +FPQLKPEEV+ IM DFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KK+  AL+IGIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 7. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 208.8 bits 778,  Expect = 4e-56
 Identities = 108/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHL+CDIEGNHL+ AAI+G+DG+VWAQS  FPQ+KPEE++AIM DFNEPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KKT  ALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 8. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 208.5 bits 777,  Expect = 5e-56
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ Y D+HLMC+IEGN L++AAI+GHDG+VWAQS +FPQLKPEE++ +M DFNEPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KKT+QALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 9. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 208.5 bits 777,  Expect = 5e-56
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVDDHLMC+IEG  NHLS+AAILG DG+VWAQS SFPQ+KP+E+SA++KDF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGEPG VIRGKKGPGG+ +KKT QALIIGIY EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 10. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 208.3 bits 776,  Expect = 6e-56
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+I+G HL++AAI+GHDG+VWAQS SFPQ+KPEE++AIMKDF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE G VIRGKKG GG+T+KKT QALI GIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 11. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 208.3 bits 776,  Expect = 6e-56
 Identities = 108/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMC+I+G HLSSAAILGHD TVWAQSP+FPQ+KPEE+SAI+ DF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTN ALIIG+Y EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 12. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 208.0 bits 775,  Expect = 7e-56
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMCDI+G+ L++AAI+GHDG+VWAQS  FPQ+K +EV+A+MKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPG VIRGKKG GG+T+KKT QALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 207.7 bits 774,  Expect = 8e-56
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMCDI+G+ L++AAI+GHDG+VWAQS SFPQ+K +EV+AIMKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLG TKYMVIQGEPG VIRGKKG GG+T+KKT+QALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 14. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 207.7 bits 774,  Expect = 8e-56
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMC+IEGN L+SAAI+G+DG+VWAQS +FPQ+KPEE++AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKGPGG+T+KKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 15. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 207.5 bits 773,  Expect = 1e-55
 Identities = 105/130 80%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMC+IEGNHLS+AAI+G+DG+VWAQS +FPQ+K EE++ IM DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKGPGGVT+KKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 16. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 207.5 bits 773,  Expect = 1e-55
 Identities = 104/131 79%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+G+HL++AAILGHDG+VWAQS +FP++KPEE++AIMKDF+EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE G VIRGKKG GGVT+KKT+QAL+ GIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 17. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 207.2 bits 772,  Expect = 1e-55
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMC+IEGNHL+SAAI+G+DG+VWA+S +FPQLKPEE++ I+ DFNEPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL++GG+KYMVIQGEPG VIRGKKGPGGVT+KKT  AL+IGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 18. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 207.2 bits 772,  Expect = 1e-55
 Identities = 105/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMCDI+G+ L++AAI+GHDG+VWAQS SFPQ+K +EV+A+MKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPG VIRGKKG GG+T+KKT QALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 19. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 207.0 bits 771,  Expect = 1e-55
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTY D+HLMC+IEGN L++AAI+GHDG+VWAQS +FPQLKPEE++ +M DFNEPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIR KKGPGGVT+KKT+QALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 20. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 206.7 bits 770,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+ LMC+IEGNHL++AAI+G+DG+VWAQS +FPQ+K EE++AIM DF+EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE G VIRGKKGPGGVT++KTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 21. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 206.4 bits 769,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HL+SAAILGHDGTVWAQS  FPQ+KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG GG+TIKKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 22. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 206.4 bits 769,  Expect = 2e-55
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDIEGN L+SAAI+GHDG+VWA S SFPQ+  EEVSAIMKDF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGVT+KKTNQALIIG+Y EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 23. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 206.4 bits 769,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HL+SAAILGHDGTVWAQS  FPQ+KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG GG+TIKKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 24. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 206.4 bits 769,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HL+SAAILGHDGTVWAQS  FPQ+KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG GG+TIKKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 25. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 205.9 bits 767,  Expect = 3e-55
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVD+HLMC+I+G+HL++AAILGHDG+VWAQS SFPQ+K EE++ IM DFNEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GGVT+KKTNQALI GIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 26. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 205.9 bits 767,  Expect = 3e-55
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHL+C IEGNHL+ AAI+G+DG+VW QS  FPQ+KPEE++AIM DFNEPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KKT  ALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 27. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 205.4 bits 765,  Expect = 4e-55
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HL+SAAI+GHDGTVWAQS +FPQ+KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG GG+T+KKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 28. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 203.8 bits 759,  Expect = 1e-54
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHL+CDI+G  L++AAI+GHDG+VWAQS +FPQ KPEE++AIMKDF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GGVTIKKTN ALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL +QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 29. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 203.8 bits 759,  Expect = 1e-54
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HL+C+IEG+HLSSAAILG+DG VWAQS  FPQ+KPEE++AIM DF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKGPGGVTI+KTNQALIIGIY +PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 30. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 203.8 bits 759,  Expect = 1e-54
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVDDHLMCDIEG  NHL+ AAILG DG+VWAQS +FPQ+KP+E++AI+K+F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKGPGG+ +KKT QALI GIY EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 31. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 203.6 bits 758,  Expect = 1e-54
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HL+SAAI+GHDG  WAQS +FP++KPEE++AIMKDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+T+KKT Q+LIIGIY EPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 32. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 203.6 bits 758,  Expect = 1e-54
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMC+IEG+HL+SAAI+GHDGTVWAQS +FP +KPEE++ IMKDF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG GGVT+KKT QAL+IGIY EPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RIGDYLVEQGM 131
            ++GDYL+EQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 33. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 203.3 bits 757,  Expect = 2e-54
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVD+HLMC+IEGNHL+SAAI+G+DG+VWAQS +FPQLKPEEV+ I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKGPGGVT+KKT  AL+IGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 34. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 203.1 bits 756,  Expect = 2e-54
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDD LMCDI+G+HL++AAILGHDG+VWA+S +FP++KPEE++AIMKDF+EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE G VIRGKKG GGVT+KKT QAL+ GIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 202.8 bits 755,  Expect = 2e-54
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HL+C+ EGNHL+SAAI+G+DGTVWAQS +FPQ+KPEE++ IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKGPGG+TIKKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 36. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 202.8 bits 755,  Expect = 2e-54
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HL+C+ EGNHL+SAAI+G+DGTVWAQS +FPQ+KPEE++ IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKGPGG+TIKKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 37. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 202.8 bits 755,  Expect = 2e-54
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHL+CDIEG HLS+AAI+GHDG+VWAQS +FP+LKPEEV+ ++KDF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG GG+TIKKT  +LIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 38. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 202.3 bits 753,  Expect = 4e-54
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HLSSAAI+GHDG VWAQS +FPQ+KPEE++ I+KDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPG VIRGKKG GG+T+KKT QAL+IGIY EPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 39. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 202.3 bits 753,  Expect = 4e-54
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVD+HLMC+IEG HLS+AAI+GHDG+VWAQS SFP+LKPEEV+ I+KDF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG GG+TIKKT  +LIIG+Y EPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 40. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 202.0 bits 752,  Expect = 4e-54
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            M WQTYVDDHLMC+IEG  NHLS AAILG DG+VWAQS SFPQ+KP+E++A++KDF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGEPG  IRGKKGPGG+ +KKT QAL+ GIY EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 41. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 201.5 bits 750,  Expect = 6e-54
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMC+IEG+HL+SAAI+GHDGTVWAQS  FPQ+KPEE++ IMKD++EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTG+ +   KYMVIQGEPG VIRGKKG GG+TIKKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 42. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 201.2 bits 749,  Expect = 7e-54
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHL C+I+G HL+SAAILGHDG VW QSP+FPQ+KPEE++ I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT   LI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYLVEQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 43. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 201.0 bits 748,  Expect = 9e-54
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS SFP +KPEE++AI+KDF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT+QAL+IGIY EP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 44. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 201.0 bits 748,  Expect = 9e-54
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS +FP +KPEE++AI+KDF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+T+KKTNQALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 45. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 200.7 bits 747,  Expect = 1e-53
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS +FP +KPEE++AI+KDF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+T+KKTNQALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 200.7 bits 747,  Expect = 1e-53
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS +FP +KPEE++AI+KDF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+T+KKTNQALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 47. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 200.5 bits 746,  Expect = 1e-53
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVDDHLMC+IEG  NHL++AAILG DG+VWAQS +FPQ+KP+E+SA++K+F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKGPGG+ +KKT QALI GIY EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 48. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 200.2 bits 745,  Expect = 2e-53
 Identities = 102/130 78%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSW+ YVDDHL C+I+G HL+SAAILGHDG+VWAQSP+FPQ+KPEE++ I+KDF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT  ALI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 49. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 199.9 bits 744,  Expect = 2e-53
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIEG--NH-LSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQ YVDDHLMCDIEG  +H L++AAI+GHDG+VWAQS +FPQ+KPEE++ IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERIGDYLVEQGM 131
            VVER+GDYLVEQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 50. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 199.7 bits 743,  Expect = 2e-53
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMCD+EGN L++AAILG+DG+VWAQS +FPQLKPEE+  I  DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEP  VIRGKKG GGVTIKKT QA++ GIY EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 51. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 199.4 bits 742,  Expect = 3e-53
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVDDHLMCDI+G   HL++A+I+GHDG++WAQS SFPQLKPEE++ IMKDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
             LAPTGL++ GTKYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 52. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 199.2 bits 741,  Expect = 3e-53
 Identities = 100/131 76%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS +FP +KPEE++AI+KD+++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+T+KKTNQALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 198.9 bits 740,  Expect = 4e-53
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQ YVDDHLMC+IEG  NHL+ AAILG DG+VWAQS  FPQ+KP+E++AI++DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGEPG VIRGKKG GG+ +KKT QAL++GIY EP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERIGDYLVEQG 130
            VER+GDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 54. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 198.9 bits 740,  Expect = 4e-53
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHL C+I+G HL+SAAILGHDG+VW +SP+FP++KPEE++ I+KDF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT  ALI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 55. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 198.9 bits 740,  Expect = 4e-53
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHL C+I+G HL+SAAILGHDG+VWA+SP+FP++KPEE++ I+KDF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT  ALI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 56. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 197.9 bits 736,  Expect = 8e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVD+HLMCDI+G   HL++AAI+GHDG+VWAQS +FPQ+K EE+S IMKDF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
             LAPTGLHLGGTKYMVIQGE G VIRGKKG GGVTIKKT+QAL+ GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 57. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 197.6 bits 735,  Expect = 9e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIEGNH---LSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQ YVDDHLMCDIEG+    L++AAI+GHDG+VWAQS +FPQ+KPEE++ IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERIGDYLVEQGM 131
            VVER+GDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 58. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 197.6 bits 735,  Expect = 9e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIEG--NH-LSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQ YVDDHLMCDIEG  +H L++AAI+GHDG+VWAQS +FPQ+KPEE++ IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G+LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+TIKKTNQAL+ GIY EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERIGDYLVEQGM 131
            VV R+GD LV+QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 59. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 196.8 bits 732,  Expect = 2e-52
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVD+HLMCD++G+ L+SAAILGHDG+VWAQS  FP+LKP E++AI+ DFNEPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GGVTIKK+N ALI G+Y EPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 60. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 196.8 bits 732,  Expect = 2e-52
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVD+HLMCDI+G   HL++AAI+GHDG++WAQS SFPQLK +E++ I KDF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
             LAPTGLHL GTKYMVIQGEPG VIRGKKG GGVTIKKT QALI GIY EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 61. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 196.3 bits 730,  Expect = 2e-52
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIEGNH---LSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQ YVDDHLMCDIEG+    L++AAI+GHDG+VWAQS +FPQ+KPEE++ IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERIGDYLVEQGM 131
            V ER+GDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 62. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 196.0 bits 729,  Expect = 3e-52
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSW+ YVDDHL C+I+G +L+SAAILGHDG+VWAQSP+FPQ+KPEE + I+KDF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT  ALI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RIGDYLVEQG 130
            R+GDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 63. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 195.3 bits 726,  Expect = 5e-52
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVD+HLMC+IEG+HL++AAI+GHDG  WAQS +FP++K E+++ IMKDF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG GG+T+KKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 64. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 195.3 bits 726,  Expect = 5e-52
 Identities = 101/128 78%, Positives = 113/128 88%, Gaps = 0/128 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ+YVDDHLMCD+EGNHL++AAILG+DG+VWAQS  FPQLKP+E+  I KDF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGG KYMVIQGE G VIRGKKGPGGVTIKKTNQAL+ G Y EPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RIGDYLVE 128
            R+GDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 65. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 195.3 bits 726,  Expect = 5e-52
 Identities = 99/131 75%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIEGN---HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQTYVDDHLMC+++GN   +LS+AAI+GHDG+VWAQS +FP++KPEE++ IMK+F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGEP  VIRGKKG GGVTIKKT QAL+ G+Y EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERIGDYLVEQGM 131
            +VER+GDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 66. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 195.0 bits 725,  Expect = 6e-52
 Identities = 98/131 74%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQ YVDDHLMCDI+GN L++AAILG+DG+VW+QS +FP ++ EE++AI+KDF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+ +KKTNQALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RIGDYLVEQGM 131
            R+GDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 67. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 194.5 bits 723,  Expect = 8e-52
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIEGNH---LSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQ YVDDHLMC++EGN    L++AAI+GHDG+VWAQS +FPQ+KPEE++ IMKDF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGEP  VIRGKKG GGVTIKKT QAL+ G+Y EP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERIGDYLVEQGM 131
            +VER+GDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 68. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 192.9 bits 717,  Expect = 2e-51
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQTYVDDHLMCDI-EGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGS 59
            MSWQ YVDDHLMCD+ +GN  +SAAI+GHDG+VWAQS +FPQLKPEEV+ IM DFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVV 119
            LAPTGL LGGTKYMVIQGE G VIRGKKG GG T+KKT QA++IGIY EPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERIGDYLVEQGM 131
            ER+GDYL+EQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 69. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 192.9 bits 717,  Expect = 2e-51
 Identities = 102/130 78%, Positives = 118/130 90%, Gaps = 4/130 3%
Query  1    MSWQTYVDDHLMCDIEG---NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
            MSWQTYVD+HLMCDI+G   N L+SA I+GHDG+VWAQS SFPQ+KP+E++ IMKDF EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
            G LAPTGLHLGG KYMVIQGE G VIRGKKG GG+TIKKT QAL+ GIY EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  VVERIGDYLVEQGM 131
            VVER+GDYL++QG+
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 70. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 191.1 bits 710,  Expect = 8e-51
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDI-EGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGS 59
            MSWQ YVDDHLMCD+ +GN L+SAAI+GHDG+VWAQS +FPQLKPEEV+ IM DFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVV 119
            LAPTGL LGGTKYMVIQGE G VI GKKG GG T+KKT QA++IGIY EPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERIGDYLVEQGM 131
            ER+GDYL+EQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 71. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 188.8 bits 701,  Expect = 4e-50
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIE--GNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQ YVD+HLMC+IE  GNHL+S+AI+G DG++WAQS +FPQ+KP+E+ AI K+F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGL LGG KYMVIQGEPG VIRGKKGPGGV IKKT QALI GIY EP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 188.2 bits 699,  Expect = 6e-50
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVDDHLMCDIEG   HL+SAAI+G DGTVWA+S SFP++KP E+ AI+K+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
             LAPTGL LGG KYMVIQGE G VIRGKKG GG+ IKKT QA++ GIY EP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYL++QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 73. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 186.7 bits 693,  Expect = 2e-49
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQ YVD+HLMCDIEG   HL+SAAILG DGTVWAQS  FPQ+KPEE+  I+K+F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTG+ + G KYMV+QGEPG VIRGKKG GG+ IKKT QA+I+GIY EP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYL+EQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 183.0 bits 679,  Expect = 2e-48
 Identities = 95/131 72%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
            MSWQTYVDDHLMCDIEG   HL++AAILG DGTVWA+S  FP++KPEE+  I+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
            +LAPTGL LGG KYMV+QGE G VIRGKKG GG+ IKKT QA+++GIY EP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERIGDYLVEQGM 131
            VER+GDYLV+Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 174.0 bits 644,  Expect = 1e-45
 Identities = 90/109 82%, Positives = 104/109 95%, Gaps = 0/109 0%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
            MSWQTYVDDHLMC+IEGN+L+SAAI+G+DG++WAQS SFPQ+KPEE++AIM DF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEP 109
            APTGL+LGGTKYMVIQGE G VIRGKKGPGGVT+KKTNQALIIGIY EP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 135.7 bits 497,  Expect = 5e-34
 Identities = 106/130 81%, Positives = 120/130 92%, Gaps = 28/130 21%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQ------------------- 41
            MSWQTYVDDHLMCD+EG+HL+SAAILG DG+VWAQSP+FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------LKPEEVSAIMKDFNEPGSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGV 92
                     +KPEE++ IMKDF+EPG LAPTGL LGGTKYMVIQGEPG VIRGKKG  G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTNQALIIGIYGEPMTPGQCNMVVERIGDYLVEQG 130
            TIKKT QALI GIY EP+TPGQCNMVVE+IGDYLV+QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 78.3 bits 276,  Expect = 8e-17
 Identities = 50/123 40%, Positives = 74/123 60%, Gaps = 6/123 4%
Query  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQ-SPSFP-QLKPEEVSAIMKDF-NEP 57
            MSWQ+YVD+++ C      L+  A L +DG VWA+    +P Q+  +E+  I     + P
Sbjct  1    MSWQSYVDNQI-CQHVDCRLAVIAGL-QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
             S+   G+HLGG KY+ IQ +   ++RG+KG   + I  TN  L+     +   PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  VVERIGDYL 126
            VVE++GDYL
Sbjct  118  VVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.