The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG
TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI
VERLGDYLVDQNM
Sequence Info Allergen Name Length Opt Bits Score E Value
AJ421031 Art v 4.0201 133 907 231.0 8.4e-63
O81982 Hel a 2 133 819 209.3 2.9e-56
AJ421030 Art v 4.0101 133 811 207.3 1.1e-55
ACS34771 Sal k 4.0101 133 753 193.0 2.3e-51
A0A0A0REA1 Koc s 2.0101 133 749 192.0 4.7e-51
ACP43298 Ama r 2.0101 133 743 190.5 1.3e-50
A0A023W2L7 Pro j 2.0101 133 730 187.3 1.2e-49
O24169 Ole e 2 134 719 184.6 8e-49
O24170 Ole e 2 134 714 183.3 1.9e-48
O49894 Mer a 1 133 713 183.1 2.2e-48
A0A0A0RCW1 Aca f 2 133 710 182.3 3.7e-48
AAL29690 Lyc e 1 131 709 182.1 4.3e-48
O24171 Ole e 2 134 709 182.1 4.4e-48
A0A2I4DNN6 Jug r 7.0101 131 708 181.9 5.1e-48
QVU02258 Que ac 2.0101 133 705 181.1 8.7e-48
O24650 Phl p 12.0102 131 704 180.9 1e-47
Q5XWE1 Citr l 2.0101 131 700 179.9 2e-47
Q9XF37 Api g 4 134 700 179.9 2.1e-47
Q9M7N0 Hev b 8.0201 131 699 179.6 2.4e-47
P35079 Phl p 12.0101 131 697 179.1 3.3e-47
CAA54686 Phl p 12.0101 131 697 179.1 3.3e-47
Q9FR39 Zea m 12.0105 131 696 178.9 4e-47
CAD10376 Cap a 2 131 695 178.7 4.7e-47
ADK22841 Sal k 4.0201 133 693 178.2 6.8e-47
AAL76933 Dau c 4 134 693 178.1 6.8e-47
QRN65366 Lig v 2.0101 134 693 178.1 6.8e-47
Q9FUD1 Ory s 12.0101 131 692 177.9 7.9e-47
Q9XF38 Pyr c 4 131 692 177.9 7.9e-47
ABU95412 Sin a 4.0101 131 690 177.4 1.1e-46
O65809 Gly m 3 131 690 177.4 1.1e-46
O22655 Zea m 12.0104 131 690 177.4 1.1e-46
O04725 Cyn d 12 131 689 177.2 1.3e-46
CAD37201 Pru p 4.0101 131 689 177.2 1.3e-46
P25816 Bet v 2 133 689 177.2 1.3e-46
Q9XF40 Mal d 4 131 688 176.9 1.6e-46
AY081850 Pru du 4.0101 131 688 176.9 1.6e-46
AY081852 Pru du 4.0102 131 688 176.9 1.6e-46
Q9STB6 Hev b 8.0102 131 687 176.7 1.9e-46
XP030492464 Can s 2.0101 133 687 176.7 1.9e-46
P49232 Tri a 12.0101 138 687 176.6 2e-46
P49233 Tri a 12.0102 141 687 176.6 2.1e-46
O24282 Phl p 12.0103 131 685 176.2 2.6e-46
AAP13533 Cuc m 2 131 685 176.2 2.6e-46
AAL07320 Lit c 1 131 684 175.9 3.1e-46
FM164277 Tri a 12.0104 131 684 175.9 3.1e-46
O65810 Gly m 3 131 683 175.7 3.7e-46
P35083 Zea m 12.0103 131 683 175.7 3.7e-46
Q9XF39 Pru av 4 131 682 175.4 4.4e-46
P35081 Zea m 12.0101 131 681 175.2 5.2e-46
Q9LEI8 Hev b 8.0204 131 681 175.2 5.2e-46
CAD37202 Pru p 4.0201 131 681 175.2 5.2e-46
Q9XF42 Mal d 4 131 680 175.0 6.1e-46
AAL92870 Che a 2 131 679 174.7 7.3e-46
Q9XG85 Par j 3 132 679 174.7 7.4e-46
P52184 Hor v 12.0101 131 678 174.5 8.6e-46
Q9AXH4 Cor a 2 131 678 174.5 8.6e-46
Q9M7M8 Hev b 8.0203 131 677 174.2 1e-45
Q8L5D8 Pho d 2.0101 131 675 173.7 1.4e-45
CAD10377 Lyc e 1 131 674 173.5 1.7e-45
Q93YG7 Sola l 1.0101 131 674 173.5 1.7e-45
O65812 Hev b 8.0101 131 673 173.2 2e-45
AAK01235 Cor a 2 131 672 173.0 2.4e-45
P84177 Cit s 2.0101 131 671 172.7 2.9e-45
P49234 Tri a 12.0103 140 671 172.7 3.2e-45
Q9XF41 Mal d 4 131 670 172.5 3.4e-45
Q9T0M8 Par j 3 131 669 172.2 4e-45
P35082 Zea m 12.0102 131 666 171.5 6.7e-45
Q42449 Ara t 8 131 666 171.5 6.7e-45
QID21357 Pop n 2.0101 131 665 171.2 8e-45
AAK54835 Ana c 1 131 664 171.0 9.5e-45
Q9M7M9 Hev b 8.0202 131 664 171.0 9.5e-45
AF377948 Mus a 1.0101 131 664 171.0 9.5e-45
Q9SQI9 Ara h 5 131 661 170.3 1.6e-44
Q5EF31 Cro s 1.0101 131 640 165.1 5.8e-43
FG438715 Act d 9.0101 109 571 148.2 6e-38
QEQ43417 Sola m 1.0101 159 466 122.0 6.6e-30
A0A1B2YLJ4 Tyr p 36.0101 131 272 74.2 1.3e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 231.0 bits 907,  Expect = 8e-63
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLVDQNM
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 2. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 209.3 bits 819,  Expect = 3e-56
 Identities = 115/133 86%, Positives = 126/133 94%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVD+HLMCDIEGTGQHLT+AAILGLDGTVWA+S KFP+FKPEEMKGII EF+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTG+F+ GAKYMVLQGE GAVIRGKKGAGGICIKKTGQAM+MGIYDEPVAPGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 3. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 207.3 bits 811,  Expect = 1e-55
 Identities = 116/133 87%, Positives = 122/133 91%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDIEGTGQHLT+AAI+G DGTVWAKS  FPEFKP E+  II EFNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGGAKYMV+QGEAGAVIRGKKGAGGICIKKTGQAMV GIYDEPVAPGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ M
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 4. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 193.0 bits 753,  Expect = 2e-51
 Identities = 103/133 77%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMC+IEGT  HLTAAAILG+DG+VWA+S  FP+FKP+E+  ++ EF+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGEAG VIRGKKG GGIC+KKTGQA++ GIYDEPV PGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 5. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 192.0 bits 749,  Expect = 5e-51
 Identities = 104/133 78%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDIEGT  HLT AAILG+DG+VWA+S  FP+FKP+E+  I+ EF+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGEAG VIRGKKG GGIC+KKTGQA++ GIYDEPV PGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 6. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 190.5 bits 743,  Expect = 1e-50
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+IEGT  HLT AAILGLDG+VWA+S  FP+FKP+E+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGE GAVIRGKKGAGGIC+KKTGQA+VMGIYDEPV PGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQ 131
            VERLGDYL++Q
Sbjct  121  VERLGDYLIEQ 131

Sequence Alignment: 7. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 187.3 bits 730,  Expect = 1e-49
 Identities = 99/133 74%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMC+IEGT  HL+AAAILG+DG+VWA+S  FP+FKP+E+  ++ +F+  G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGE G VIRGKKG GGIC+KKTGQA+++GIYDEPV PGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 8. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 184.6 bits 719,  Expect = 8e-49
 Identities = 104/133 78%, Positives = 116/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQH-LTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
            MSWQ YVDDHLMCDIEG   H LTAAAI+G DG+VWA+S  FP+FKPEEM GI+ +FNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
            G LAPTGL LGG KYMV+QGEAGAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVDQNM 133
            +VERLGDYLV+Q M
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 9. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 183.3 bits 714,  Expect = 2e-48
 Identities = 102/133 76%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEG-TGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
            MSWQ YVDDHLMCDIEG  G+ LTAAAI+G DG+VWA+S  FP+FKPEEM GI+ +FNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
            G LAPTGL LGG KYMV+QGEAGAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVDQNM 133
            +VERLGDYL++Q +
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 10. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 183.1 bits 713,  Expect = 2e-48
 Identities = 96/133 72%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDI+G GQHL AA+I+G DG++WA+S  FP++KPEE+ GI+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGL++ G KYMV+QGE+GAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 11. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 182.3 bits 710,  Expect = 4e-48
 Identities = 97/133 72%, Positives = 113/133 84%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            M WQTYVDDHLMC+IEGT  HL+ AAILG+DG+VWA+S  FP+FKP+E+  ++ +F+  G
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGE G  IRGKKG GGIC+KKTGQA+V GIYDEPV PGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 12. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 182.1 bits 709,  Expect = 4e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDIEG   HLT+AAI+G DG+VWA+S  FP+FKPEE+  I+N+F E G
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGEAGAVIRGKKGAGGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDY+++Q +
Sbjct  119  VERLGDYIIEQGL 131

Sequence Alignment: 13. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 182.1 bits 709,  Expect = 4e-48
 Identities = 101/133 75%, Positives = 116/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEG-TGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
            MSWQ YVDDHLMCDIEG  G+ LTAAAI+G DG+VWA+S  FP+FKPEEM GI+ +FNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
            G LAPTGL LGG KYMV+QGEAGAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVDQNM 133
            + ERLGDYL++Q +
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 14. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 181.9 bits 708,  Expect = 5e-48
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+I+  GQHLTAAAI+G DG+VWA+S  FP+FKPEE+  I+ +F+E G
Sbjct  1    MSWQTYVDEHLMCEID--GQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGEAGAVIRGKKGAGGI +KKTGQA++ GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q +
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 15. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 181.1 bits 705,  Expect = 9e-48
 Identities = 98/133 73%, Positives = 114/133 85%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMCDI+G GQHL AAAI+G DG+VWA+S  FP+FK EE+  I+ +F E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGL LGG KYMV+QGEAGAVIRGKKG+GG+ IKKT QA+V GIY+EPV PGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLVDQ +
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 16. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 180.9 bits 704,  Expect = 1e-47
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HL +AAILG DGTVWA+S  FP+FKPEE+ GI+ +F+E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTG+F+ GAKYMV+QGE GAVIRGKKGAGGI IKKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 17. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 179.9 bits 700,  Expect = 2e-47
 Identities = 96/131 73%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+IEG   HLT+AAI+G DG+VWAKS+ FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL++GG+KYMV+QGE GAVIRGKKG GG+ +KKT  A+V+GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 18. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 179.9 bits 700,  Expect = 2e-47
 Identities = 97/133 72%, Positives = 116/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGT-GQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
            MSWQ YVDDHLMC++EG  GQ LTAAAI+G DG+VWA+S  FP+ KPEE+ GI+ +F+E 
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
            G LAPTGL+LGGAKYMV+QGE  AVIRGKKG+GG+ IKKTGQA+V G+YDEPV PGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  IVERLGDYLVDQNM 133
            IVERLGDYL+DQ +
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 19. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 179.6 bits 699,  Expect = 2e-47
 Identities = 97/131 74%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMCDI+  G+HLTAAAI+G DG+VWA+S  FP+FKPEE+  I+ +F+E G
Sbjct  1    MSWQTYVDEHLMCDID--GHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE GAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 20. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 179.1 bits 697,  Expect = 3e-47
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HL +AAILG DGTVWA+S  FP+FKPEE+ GI+ +F+E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTG+F+ GAKYMV+QGE G VIRGKKGAGGI IKKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 21. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 179.1 bits 697,  Expect = 3e-47
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HL +AAILG DGTVWA+S  FP+FKPEE+ GI+ +F+E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTG+F+ GAKYMV+QGE G VIRGKKGAGGI IKKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 22. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 178.9 bits 696,  Expect = 4e-47
 Identities = 95/129 73%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHL+CDIE  GQHL+AAAI+G DG+VWA+S+ FPE+KPEE+ G+I +F+E G
Sbjct  1    MSWQAYVDDHLLCDIE--GQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLF+GG KYMV+QGE G VIRGKKG GGI IKKTG ++++GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL++Q
Sbjct  119  VERLGDYLIEQ 129

Sequence Alignment: 23. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 178.7 bits 695,  Expect = 5e-47
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMC+IEG    LT+AAI+G DG+VWA+S  FP+FKPEE+  I+N+F E G
Sbjct  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL+LGG KYMV+QGEAGAVIRGKKG GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q++
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 24. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 178.2 bits 693,  Expect = 7e-47
 Identities = 93/133 69%, Positives = 115/133 86%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVD+HLMC+IE TG HLT++AI+G+DG++WA+S  FP+ KP+E++ I  EF+   
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGE GAVIRGKKG GG+CIKKT QA++ GIYDEPVAPGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 25. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 178.1 bits 693,  Expect = 7e-47
 Identities = 95/133 71%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGT-GQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
            MSWQTYVDDHLMC+++G  GQ+L+AAAI+G DG+VWA+S  FP+FKPEE+ GI+  F+E 
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
            G LAPTGL+LGG KYMV+QGE  AVIRGKKG+GG+ IKKTGQA+V G+YDEPV PGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  IVERLGDYLVDQNM 133
            IVERLGDYL++Q +
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 26. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 178.1 bits 693,  Expect = 7e-47
 Identities = 101/133 75%, Positives = 113/133 84%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQH-LTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
            MSWQ YVDDHLMCDIEG   H LTAAAI+G DG+VWA+S  FP+FKPEE+ GI+ +FNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
            GTLAPTGL LGG KYMV+QGEAGAVIRGKKG+GGI IKKT QA+V GIY+EPV PGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVDQNM 133
            +V RLGD LV Q M
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 27. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 177.9 bits 692,  Expect = 8e-47
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HLT+AAI+G DGTVWA+S  FP+FKPEEM  I+ +F+E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLG  KYMV+QGE GAVIRGKKG+GGI +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q +
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 28. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 177.9 bits 692,  Expect = 8e-47
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+  G+HLTAAAILG DG+VWA+S  FP+FKPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLMCDID--GHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE GAVIRGKKG+GG+ +KKT QA+V GIY+EP+ PGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 29. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 177.4 bits 690,  Expect = 1e-46
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCD+EG    LTAAAILG DG+VWA+S  FP++KPEE+KGI N+F E G
Sbjct  1    MSWQTYVDDHLMCDVEGN--RLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLF+GG KYMV+QGE  AVIRGKKGAGG+ IKKT QA V GIY+EP+ PGQCNM+
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 30. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 177.4 bits 690,  Expect = 1e-46
 Identities = 94/129 72%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHL+CDIEG   HLT AAI+G DG+VWA+S  FP+FKPEE+  I+N+FNE G
Sbjct  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG GG+ +KKTG A+++GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQ 131
            VER GDYL+DQ
Sbjct  119  VERPGDYLIDQ 129

Sequence Alignment: 31. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 177.4 bits 690,  Expect = 1e-46
 Identities = 94/129 72%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVD+HLMC+IE  GQHL+AAAI+G DG+VWA+S+ FPE+KPEE+ GII +F+E G
Sbjct  1    MSWQAYVDEHLMCEIE--GQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLF+GG KYMV+QGE G VIRGKKG GGI IKKTG ++++G+YDEP+ PGQCNM+
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL++Q
Sbjct  119  VERLGDYLIEQ 129

Sequence Alignment: 32. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 177.2 bits 689,  Expect = 1e-46
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+IE  G+HLT+AAI+G DGTVWA+S  FP FKPEEM  I+ +F+E G
Sbjct  1    MSWQAYVDDHLMCEIE--GHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLG  KYMV+QGE GAVIRGKKG+GG+ +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            +E+LGDYL++Q M
Sbjct  119  IEKLGDYLIEQGM 131

Sequence Alignment: 33. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 177.2 bits 689,  Expect = 1e-46
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP FKPEE+  I+ +F++ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGEAGAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 34. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 177.2 bits 689,  Expect = 1e-46
 Identities = 95/133 71%, Positives = 114/133 85%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMCDI+G   +  A+AI+G DG+VWA+S  FP+FKP+E+ GI+ +F E G
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGL LGG KYMV+QGEAGAVIRGKKG+GGI IKKTGQA+V GIY+EPV PGQCNM+
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 35. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 176.9 bits 688,  Expect = 2e-46
 Identities = 96/131 73%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDD LMCDI+  G+HLTAAAILG DG+VWA S  FP+FKPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDDRLMCDID--GHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE GAVIRGKKG+GG+ +KKTGQA+V GIY+EP+ PGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 176.9 bits 688,  Expect = 2e-46
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP FKPEE+  I+ +F++ G
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGEAGAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 176.9 bits 688,  Expect = 2e-46
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP FKPEE+  I+ +F++ G
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGEAGAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 176.7 bits 687,  Expect = 2e-46
 Identities = 94/129 72%, Positives = 115/129 89%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+IEG   HL+AAAI+G DG+VWA+S  FP+FK EE+ GI+++F+E G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL++GG KYMV+QGE GAVIRGKKG GG+ +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL+DQ
Sbjct  119  VERLGDYLIDQ 129

Sequence Alignment: 39. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 176.7 bits 687,  Expect = 2e-46
 Identities = 94/133 70%, Positives = 113/133 84%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMCDI+G GQHLTAAAI+G DG++WA+S  FP++K +E+  I  +F E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGL L G KYMV+QGE GAVIRGKKG+GG+ IKKTGQA++ GIY+EPV PGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQNM 133
            VERLGDYLVDQ +
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 40. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 176.6 bits 687,  Expect = 2e-46
 Identities = 95/129 73%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHL C+I+  GQHLT+AAILG DG+VW +S  FP+FKPEE+ GI+ +F E G
Sbjct  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG A+++GIYDEP+ PGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL+DQ
Sbjct  119  VERLGDYLIDQ 129

Sequence Alignment: 41. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 176.6 bits 687,  Expect = 2e-46
 Identities = 95/129 73%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHL C+I+  GQHLT+AAILG DG+VWA+S  FP+FKPEE+ GI+ +F E G
Sbjct  1    MSWQAYVDDHLCCEID--GQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG A+++GIYDEP+ PGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL+DQ
Sbjct  119  VERLGDYLIDQ 129

Sequence Alignment: 42. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 176.2 bits 685,  Expect = 3e-46
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HL +AAI+G DGTVWA+S  FP+FKPEE+ GI+ +++E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTG+F+  AKYMV+QGE GAVIRGKKGAGGI IKKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q M
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 43. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 176.2 bits 685,  Expect = 3e-46
 Identities = 93/131 70%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVD+HLMC+IEG   HLT+AAI+G DG+VWA+S  FP++KPEE+ GI+ +F + G
Sbjct  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL++GG KYMV+QGE GAVIRGKKG GG+ +KKTG A+V+GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 44. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 175.9 bits 684,  Expect = 3e-46
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMC+ +  GQHLTAAAI+G DG+VWA+S  FP+FKP E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCETD--GQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE GAVIRGKKG GGI +KKT QA+++GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLVDQ +
Sbjct  119  VERLGDYLVDQGL 131

Sequence Alignment: 45. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 175.9 bits 684,  Expect = 3e-46
 Identities = 94/129 72%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSW+ YVDDHL C+I+  GQHLT+AAILG DG+VWA+S  FP+FKPEE+ GI+ +F E G
Sbjct  1    MSWKAYVDDHLCCEID--GQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG A+++GIYDEP+ PGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL+DQ
Sbjct  119  VERLGDYLIDQ 129

Sequence Alignment: 46. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 175.7 bits 683,  Expect = 4e-46
 Identities = 93/129 72%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHL+C IEG   HLT AAI+G DG+VW +S  FP+FKPEE+  I+N+FNE G
Sbjct  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG GG+ +KKTG A+++GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL+DQ
Sbjct  119  VERLGDYLIDQ 129

Sequence Alignment: 47. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 175.7 bits 683,  Expect = 4e-46
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HL++AAI+G DG VWA+S  FP+FKPEEM  II +F+E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAP GLFLG  KYMV+QGE GAVIRGKKG+GGI +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q +
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 48. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 175.4 bits 682,  Expect = 4e-46
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP FKPEE+  I+ ++++ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGEAGAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 49. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 175.2 bits 681,  Expect = 5e-46
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMC+IE  G+HLT+AAI+G DG  WA+S  FPEFKPEEM  I+ +F+E G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGL LGG KYMV+QGE GAVIRGKKG+GGI +KKTGQ++++GIYDEP+ PGQCN++
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 50. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 175.2 bits 681,  Expect = 5e-46
 Identities = 94/131 71%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDI+  G+ LTAAAI+G DG+VWA+S  FP+FK +E+  ++ +F+E G
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE GAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLLDQGL 131

Sequence Alignment: 51. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 175.2 bits 681,  Expect = 5e-46
 Identities = 94/131 71%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+IEG   HL+AAAI+G DG+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG GG+ +KK+  A+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYLV+Q +
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 52. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 175.0 bits 680,  Expect = 6e-46
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP FKPEE+  I+ +F++ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGE GAVIRGKKG+GGI IKKT QA+++GIYDEPV PGQCN++
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 174.7 bits 679,  Expect = 7e-46
 Identities = 95/131 72%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDIEG   HL++AAILG DGTVWA+S  FP++KPEE+  I+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE G VIRGKKG GG+ IKKT QA+++GIY EP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VER+GDYLV+Q M
Sbjct  119  VERIGDYLVEQGM 131

Sequence Alignment: 54. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 174.7 bits 679,  Expect = 7e-46
 Identities = 93/132 70%, Positives = 115/132 87%, Gaps = 1/132 0%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCD+ G G    +AAI+G DG+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE+GAVIRGKKG+GG  +KKTGQA+V+GIYDEP+ PGQCN++
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  120  VERLGDYLLEQGL 132

Sequence Alignment: 55. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 174.5 bits 678,  Expect = 9e-46
 Identities = 95/129 73%, Positives = 111/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHL C+I+  GQHLT+AAILG DG VW +S  FP+FKPEE+ GII +F+E G
Sbjct  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG  +++GIYDEP+ PGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYLV+Q
Sbjct  119  VERLGDYLVEQ 129

Sequence Alignment: 56. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 174.5 bits 678,  Expect = 9e-46
 Identities = 92/131 70%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ Y D+HLMC+IEG    L AAAI+G DG+VWA+S  FP++KPEE+ G++N+FNE G
Sbjct  1    MSWQAYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG GG+ +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 57. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 174.2 bits 677,  Expect = 1e-45
 Identities = 94/131 71%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDI+  G+ LTAAAI+G DG+VWA+S  FP+FK +E+  ++ +F+E G
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LGG KYMV+QGE GAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 58. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 173.7 bits 675,  Expect = 1e-45
 Identities = 92/131 70%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVD+HLMC+I+  G+HLTAAAILG DG+VWA+S  FP+FK EE+  I+N+FNE G
Sbjct  1    MSWQAYVDEHLMCEID--GHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LG  KYMV+QGE GAVIRGKKG+GG+ +KKT QA++ GIY+EP+ PGQCNM+
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLIEQGM 131

Sequence Alignment: 59. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 173.5 bits 674,  Expect = 2e-45
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HL+C+ EG   HLT+AAI+G DGTVWA+S  FP+FKPEE+ GI+N+F   G
Sbjct  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL+LGG KYMV+QGE  AVIRGKKG GGI IKKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q++
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 60. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 173.5 bits 674,  Expect = 2e-45
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HL+C+ EG   HLT+AAI+G DGTVWA+S  FP+FKPEE+ GI+N+F   G
Sbjct  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL+LGG KYMV+QGE  AVIRGKKG GGI IKKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q++
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 61. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 173.2 bits 673,  Expect = 2e-45
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+ LMC+IEG   HLTAAAI+G DG+VWA+S  FP+FK EE+  I+++F+E G
Sbjct  1    MSWQTYVDERLMCEIEGN--HLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGL LGG KYMV+QGEAGAVIRGKKG GG+ ++KT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 62. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 173.0 bits 672,  Expect = 2e-45
 Identities = 92/131 70%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTY D+HLMC+IEG    L AAAI+G DG+VWA+S  FP++KPEE+ G++N+FNE G
Sbjct  1    MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GAVIR KKG GG+ +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 63. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 172.7 bits 671,  Expect = 3e-45
 Identities = 94/131 71%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDI+G    LTAAAILG DG+VW++S  FP F+ EE+  I+ +F++ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            TLAPTGLFLGG KYMV+QGEAGAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 64. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 172.7 bits 671,  Expect = 3e-45
 Identities = 93/129 72%, Positives = 111/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSW+ YVDDHL C+I+  GQ+LT+AAILG DG+VWA+S  FP+FKPEE  GI+ +F E G
Sbjct  1    MSWKAYVDDHLCCEID--GQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG A+++GIYDEP+ PGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL+DQ
Sbjct  119  VERLGDYLIDQ 129

Sequence Alignment: 65. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 172.5 bits 670,  Expect = 3e-45
 Identities = 90/131 68%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+IEG   HL+AAAI+G +G+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE G VIRGKKG GG+ +KK+  A+++GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q +
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 66. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 172.2 bits 669,  Expect = 4e-45
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCD+ G G  L +AAI+G DG+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE+GAVI GKKG+GG  +KKTGQA+V+GIYDEP+ PGQCN++
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 67. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 171.5 bits 666,  Expect = 7e-45
 Identities = 94/131 71%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVD+HLMC+IE  G+HL AAAI+G DG  WA+S  FPEFK E+M  I+ +F+E G
Sbjct  1    MSWQAYVDEHLMCEIE--GHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLG  KYMV+QGE GAVIRGKKG+GGI +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 68. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 171.5 bits 666,  Expect = 7e-45
 Identities = 93/131 70%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ+YVDDHLMCD+EG   HLTAAAILG DG+VWA+S KFP++KP+E+ GI  +F E G
Sbjct  1    MSWQSYVDDHLMCDVEGN--HLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
             LAPTGLFLGG KYMV+QGE GAVIRGKKG GG+ IKKT QA+V G YDEP+  GQCN++
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++  +
Sbjct  119  VERLGDYLIESEL 131

Sequence Alignment: 69. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 171.2 bits 665,  Expect = 8e-45
 Identities = 92/131 70%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMCDIEG    LT+AAI+G DG+VWA S  FP+F  EE+  I+ +F E G
Sbjct  1    MSWQVYVDDHLMCDIEGN--TLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGLFLGG KYMV+QGE GAVIRGKKG+GG+ +KKT QA+++G+YDEP+ PGQCNMI
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+DQ +
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 70. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 171.0 bits 664,  Expect = 9e-45
 Identities = 90/129 69%, Positives = 111/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHLMC+I+  GQHL++AAILG D TVWA+S  FP+FKPEE+  I+N+F   G
Sbjct  1    MSWQAYVDDHLMCEID--GQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE G VIRGKKG GGI +KKT  A+++G+YDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL++Q
Sbjct  119  VERLGDYLLEQ 129

Sequence Alignment: 71. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 171.0 bits 664,  Expect = 9e-45
 Identities = 93/131 70%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMCDI+  G+ LTAAAI+G DG+VWA+S  FP+FK +E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL LG  KYMV+QGE GAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL++Q M
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 72. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 171.0 bits 664,  Expect = 9e-45
 Identities = 92/129 71%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQ YVDDHL+CDI+  GQ LTAAAI+G DG+VWA+SD FP+ KPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLLCDID--GQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG+GG+ IKKT  A+++GIY+EP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL DQ
Sbjct  119  VERLGDYLFDQ 129

Sequence Alignment: 73. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 170.3 bits 661,  Expect = 2e-44
 Identities = 90/131 68%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HL+C+IE  G HL++AAILG DG VWA+S  FP+FKPEE+  I+N+F E G
Sbjct  1    MSWQTYVDNHLLCEIE--GDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTGL+LGG KYMV+QGE GA+I GKKG GG+ I+KT QA+++GIYD+P+ PGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLVDQNM 133
            VERLGDYL+D  +
Sbjct  119  VERLGDYLIDTGL 131

Sequence Alignment: 74. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 165.1 bits 640,  Expect = 6e-43
 Identities = 86/129 66%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVD+HLMCD++  G+ LT+AAILG DG+VWA+S  FPE+KP E+  I+N+FNE G
Sbjct  1    MSWQTYVDEHLMCDMD--GHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
            +LAPTG+++ GAKYMV+QGE G VIRGKKG+GG+ IKK+  A++ G+YDEP+ PGQCN++
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQ 131
            VERLGDYL++Q
Sbjct  119  VERLGDYLIEQ 129

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 148.2 bits 571,  Expect = 6e-38
 Identities = 79/109 72%, Positives = 98/109 89%, Gaps = 2/109 1%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
            MSWQTYVDDHLMC+IEG   +LT+AAI+G DG++WA+S  FP+FKPEE+  I+N+F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEP 111
            TLAPTGL+LGG KYMV+QGEAGAVIRGKKG GG+ +KKT QA+++GIYDEP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 122.0 bits 466,  Expect = 7e-30
 Identities = 96/129 74%, Positives = 115/129 89%, Gaps = 30/129 23%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPE----------------- 43
            MSWQTYVDDHLMCD+E  G+HL +AAILG+DG+VWA+S  FP+                 
Sbjct  1    MSWQTYVDDHLMCDLE--GHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------FKPEEMKGIINEFNEVGTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAG 92
                       FKPEE+  I+ +F+E G LAPTGLFLGG KYMV+QGE GAVIRGKKG+ 
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GICIKKTGQAMVMGIYDEPVAPGQCNMIVERLGDYLVDQ 131
            GI IKKTGQA++ GIY+EPV PGQCNM+VE++GDYLVDQ
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQ 157

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.2 bits 272,  Expect = 1e-15
 Identities = 51/124 41%, Positives = 80/124 64%, Gaps = 14/124 11%
Query  1    MSWQTYVDDHLMCDIEGTGQHLTA--AAILGL-DGTVWAKSDK-FP-EFKPEEMKGIINE 55
            MSWQ+YVD+++ C      QH+    A I GL DG VWAK +K +P +   +E+K I + 
Sbjct  1    MSWQSYVDNQI-C------QHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADA 53
Query  56   F-NEVGTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAP 114
              +   ++   G+ LGG KY+ +Q +  +++RG+KG+  +CI  T   ++     +   P
Sbjct  54   IRSNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPP 112
Query  115  GQCNMIVERLGDYLVDQN 132
            GQ N +VE+LGDYL   N
Sbjct  113  GQLNNVVEKLGDYLKANN 130

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.