The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL
APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE
RLGDYLIEQSL
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD10376 Cap a 2 131 878 232.6 2.8e-63
AAL29690 Lyc e 1 131 837 222.0 4.2e-60
Q93YG7 Sola l 1.0101 131 813 215.8 3e-58
CAD10377 Lyc e 1 131 813 215.8 3e-58
Q9STB6 Hev b 8.0102 131 801 212.7 2.6e-57
O65812 Hev b 8.0101 131 798 211.9 4.4e-57
Q9AXH4 Cor a 2 131 795 211.2 7.6e-57
CAD37201 Pru p 4.0101 131 795 211.2 7.6e-57
AY081850 Pru du 4.0101 131 794 210.9 9e-57
AY081852 Pru du 4.0102 131 794 210.9 9e-57
CAD37202 Pru p 4.0201 131 792 210.4 1.3e-56
Q5XWE1 Citr l 2.0101 131 792 210.4 1.3e-56
AAK01235 Cor a 2 131 789 209.6 2.2e-56
Q9XF39 Pru av 4 131 788 209.4 2.6e-56
Q9XF41 Mal d 4 131 787 209.1 3.2e-56
O65809 Gly m 3 131 786 208.8 3.8e-56
Q9SQI9 Ara h 5 131 785 208.6 4.5e-56
O65810 Gly m 3 131 783 208.1 6.4e-56
AAL07320 Lit c 1 131 780 207.3 1.1e-55
AAP13533 Cuc m 2 131 780 207.3 1.1e-55
A0A2I4DNN6 Jug r 7.0101 131 776 206.3 2.3e-55
AAL92870 Che a 2 131 774 205.8 3.2e-55
P84177 Cit s 2.0101 131 772 205.2 4.6e-55
ABU95412 Sin a 4.0101 131 771 205.0 5.5e-55
QID21357 Pop n 2.0101 131 769 204.5 7.9e-55
Q9XF42 Mal d 4 131 768 204.2 9.4e-55
Q9M7N0 Hev b 8.0201 131 767 204.0 1.1e-54
Q9FUD1 Ory s 12.0101 131 767 204.0 1.1e-54
Q9LEI8 Hev b 8.0204 131 762 202.7 2.7e-54
Q9M7M8 Hev b 8.0203 131 760 202.1 3.9e-54
Q8L5D8 Pho d 2.0101 131 759 201.9 4.7e-54
Q9XF38 Pyr c 4 131 759 201.9 4.7e-54
Q9M7M9 Hev b 8.0202 131 758 201.6 5.6e-54
AAK54835 Ana c 1 131 754 200.6 1.1e-53
A0A023W2L7 Pro j 2.0101 133 752 200.1 1.7e-53
O24650 Phl p 12.0102 131 751 199.8 2e-53
A0A0A0REA1 Koc s 2.0101 133 751 199.8 2e-53
O24170 Ole e 2 134 751 199.8 2e-53
O24169 Ole e 2 134 751 199.8 2e-53
O04725 Cyn d 12 131 750 199.6 2.3e-53
P35083 Zea m 12.0103 131 748 199.1 3.3e-53
P35081 Zea m 12.0101 131 747 198.8 4e-53
ACS34771 Sal k 4.0101 133 746 198.5 4.9e-53
O24171 Ole e 2 134 746 198.5 4.9e-53
QRN65366 Lig v 2.0101 134 746 198.5 4.9e-53
P35079 Phl p 12.0101 131 744 198.0 6.8e-53
CAA54686 Phl p 12.0101 131 744 198.0 6.8e-53
ACP43298 Ama r 2.0101 133 744 198.0 7e-53
Q9XF40 Mal d 4 131 742 197.5 9.8e-53
Q42449 Ara t 8 131 740 197.0 1.4e-52
AAL76933 Dau c 4 134 737 196.2 2.5e-52
AF377948 Mus a 1.0101 131 735 195.7 3.4e-52
O24282 Phl p 12.0103 131 734 195.4 4.1e-52
A0A0A0RCW1 Aca f 2 133 730 194.4 8.5e-52
Q9XG85 Par j 3 132 729 194.2 1e-51
O22655 Zea m 12.0104 131 728 193.9 1.2e-51
Q9XF37 Api g 4 134 728 193.9 1.2e-51
O49894 Mer a 1 133 725 193.1 2.1e-51
Q5EF31 Cro s 1.0101 131 722 192.4 3.5e-51
FM164277 Tri a 12.0104 131 722 192.4 3.5e-51
Q9FR39 Zea m 12.0105 131 722 192.4 3.5e-51
P52184 Hor v 12.0101 131 719 191.6 5.9e-51
QVU02258 Que ac 2.0101 133 717 191.1 8.7e-51
P49232 Tri a 12.0101 138 717 191.0 9.2e-51
P49233 Tri a 12.0102 141 717 191.0 9.5e-51
Q9T0M8 Par j 3 131 716 190.8 1e-50
P25816 Bet v 2 133 716 190.8 1e-50
FG438715 Act d 9.0101 109 712 189.9 1.6e-50
P35082 Zea m 12.0102 131 713 190.0 1.7e-50
P49234 Tri a 12.0103 140 713 190.0 1.9e-50
ADK22841 Sal k 4.0201 133 697 185.9 3.1e-49
AJ421030 Art v 4.0101 133 696 185.6 3.7e-49
AJ421031 Art v 4.0201 133 695 185.4 4.4e-49
XP030492464 Can s 2.0101 133 693 184.9 6.3e-49
O81982 Hel a 2 133 681 181.8 5.4e-48
QEQ43417 Sola m 1.0101 159 491 132.7 3.8e-33
A0A1B2YLJ4 Tyr p 36.0101 131 283 79.2 4e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 232.6 bits 878,  Expect = 3e-63
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQSL
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 2. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 222.0 bits 837,  Expect = 4e-60
 Identities = 124/131 94%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMC+IEGN LTSAAIIGQDGSVWAQSA FPQFKPEEITAIMNDFAEPGTL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGITVKKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDY+IEQ L
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 3. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 215.8 bits 813,  Expect = 3e-58
 Identities = 120/131 91%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HL+CE EGN LTSAAIIGQDG+VWAQSA FPQFKPEEIT IMNDFA PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE  AVIRGKKGPGGIT+KKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQSL
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 4. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 215.8 bits 813,  Expect = 3e-58
 Identities = 120/131 91%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HL+CE EGN LTSAAIIGQDG+VWAQSA FPQFKPEEIT IMNDFA PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE  AVIRGKKGPGGIT+KKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQSL
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 5. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 212.7 bits 801,  Expect = 3e-57
 Identities = 116/129 89%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMCEIEGN L++AAIIGQDGSVWAQSA FPQFK EEIT IM+DF EPGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGE GAVIRGKKGPGG+TVKKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 6. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 211.9 bits 798,  Expect = 4e-57
 Identities = 116/131 88%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+ LMCEIEGN LT+AAIIGQDGSVWAQS+ FPQFK EEITAIM+DF EPGTL
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKGPGG+TV+KTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 211.2 bits 795,  Expect = 8e-57
 Identities = 114/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ Y D+HLMCEIEGNRL +AAIIG+DGSVWAQS+TFPQ+KPEEIT +MNDF EPG+L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGG+TVKKT+QALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 8. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 211.2 bits 795,  Expect = 8e-57
 Identities = 115/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSATFP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGITVKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 9. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 210.9 bits 794,  Expect = 9e-57
 Identities = 115/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSATFP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGITVKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 10. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 210.9 bits 794,  Expect = 9e-57
 Identities = 115/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSATFP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGITVKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 11. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 210.4 bits 792,  Expect = 1e-56
 Identities = 112/131 85%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMCEIEGN L++AAIIG+DGSVWAQSATFPQ+KPEE+T I+NDF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGG+TVKK+  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 12. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 210.4 bits 792,  Expect = 1e-56
 Identities = 114/131 87%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMCEIEGN LTSAAIIGQDGSVWA+S  FPQ+KPEEIT I+NDF EPGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLY+GG+KYMVIQGE GAVIRGKKGPGG+TVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 13. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 209.6 bits 789,  Expect = 2e-56
 Identities = 114/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTY D+HLMCEIEGNRL +AAIIG+DGSVWAQS+TFPQ+KPEEIT +MNDF EPG+L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GAVIR KKGPGG+TVKKT+QALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 14. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 209.4 bits 788,  Expect = 3e-56
 Identities = 114/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSATFP FKPEEI AI+ D+ +PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGITVKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 15. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 209.1 bits 787,  Expect = 3e-56
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMCEIEGN L++AAIIG++GSVWAQSATFPQ+KPEE+T IMNDF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE G VIRGKKGPGG+TVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 16. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 208.8 bits 786,  Expect = 4e-56
 Identities = 113/129 87%, Positives = 119/129 92%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHL+C+IEGN LT AAIIGQDGSVWAQS  FPQFKPEEITAIMNDF EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQ 129
            R GDYLI+Q
Sbjct  121  RPGDYLIDQ 129

Sequence Alignment: 17. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 208.6 bits 785,  Expect = 5e-56
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HL+CEIEG+ L+SAAI+GQDG VWAQS+ FPQFKPEEITAIMNDFAEPG+L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GA+I GKKGPGG+T++KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 18. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 208.1 bits 783,  Expect = 6e-56
 Identities = 113/129 87%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHL+C IEGN LT AAIIGQDGSVW QS  FPQFKPEEITAIMNDF EPG+L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 19. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 207.3 bits 780,  Expect = 1e-55
 Identities = 112/131 85%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMCE +G  LT+AAIIG+DGSVWAQSA FPQFKP EI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGPGGITVKKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 20. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 207.3 bits 780,  Expect = 1e-55
 Identities = 111/131 84%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVD+HLMCEIEGN LTSAAIIGQDGSVWAQS  FPQ+KPEE+  I+ DFA+PGTL
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGE GAVIRGKKGPGG+TVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 21. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 206.3 bits 776,  Expect = 2e-55
 Identities = 112/131 85%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEI+G  LT+AAIIG+DGSVWAQS++FPQFKPEEI AIM DF EPG+L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGITVKKT QALI GIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 22. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 205.8 bits 774,  Expect = 3e-55
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMC+IEGN L+SAAI+G+DG+VWAQS +FPQ+KPEE++AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKGPGG+T+KKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            R+GDYL+EQ +
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 23. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 205.2 bits 772,  Expect = 5e-55
 Identities = 112/131 85%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSATFP F+ EEI AI+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEAGAVIRGKKG GGI VKKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 24. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 205.0 bits 771,  Expect = 5e-55
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMC++EGNRLT+AAI+GQDGSVWAQSA FPQ+KPEEI  I NDFAEPGTL
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE  AVIRGKKG GG+T+KKT QA++ GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 25. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 204.5 bits 769,  Expect = 8e-55
 Identities = 110/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+IEGN LTSAAIIG+DGSVWA SA+FPQF  EE++AIM DF EPG+L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKTNQALIIG+YDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 26. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 204.2 bits 768,  Expect = 9e-55
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+GNRLT+AAI+GQDGSVW+QSA+FP FKPEEI AI+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGIT+KKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 27. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 204.0 bits 767,  Expect = 1e-54
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMC+I+G+ LT+AAIIG+DGSVWAQS++FPQFKPEE+ AIM DF EPG+L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 28. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 204.0 bits 767,  Expect = 1e-54
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ LTSAAI+G+DG+VWAQSA FPQFKPEE+T IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 29. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 202.7 bits 762,  Expect = 3e-54
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMC+I+G+RLT+AAIIG+DGSVWAQS++FPQFK +E+ A+M DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 30. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 202.1 bits 760,  Expect = 4e-54
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMC+I+G+RLT+AAIIG+DGSVWAQS+ FPQFK +E+ A+M DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 31. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 201.9 bits 759,  Expect = 5e-54
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVD+HLMCEI+G+ LT+AAI+G+DGSVWAQS++FPQFK EEIT IMNDF EPG+L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLG TKYMVIQGE GAVIRGKKG GG+TVKKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 32. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 201.9 bits 759,  Expect = 5e-54
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMC+I+G+ LT+AAI+G+DGSVWAQS+TFP+FKPEEITAIM DF EPG+L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT+QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 33. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 201.6 bits 758,  Expect = 6e-54
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMC+I+G+RLT+AAIIG+DGSVWAQS++FPQFK +E+ AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGITVKKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 34. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 200.6 bits 754,  Expect = 1e-53
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMCEI+G  L+SAAI+G+D +VWAQS  FPQFKPEEI+AI+NDF  PG+L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE G VIRGKKG GGITVKKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 35. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 200.1 bits 752,  Expect = 2e-53
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVDDHLMCEIEG  N L++AAI+G DGSVWAQSA+FPQFKP+EI+A++ DF  PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGE G VIRGKKGPGGI VKKT QALIIGIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 36. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 199.8 bits 751,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ L SAAI+G+DG+VWAQSA FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGE GAVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 37. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 199.8 bits 751,  Expect = 2e-53
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVDDHLMC+IEG  N LT AAI+G DGSVWAQSA FPQFKP+EI AI+ +F EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGEAG VIRGKKGPGGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 38. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 199.8 bits 751,  Expect = 2e-53
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQ YVDDHLMC+IEG+   RLT+AAI+G+DGSVWAQSATFPQFKPEE+  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGEAGAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            +VERLGDYL+EQ L
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 39. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 199.8 bits 751,  Expect = 2e-53
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQ YVDDHLMC+IEG+   RLT+AAI+G+DGSVWAQSATFPQFKPEE+  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGEAGAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            +VERLGDYL+EQ +
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 40. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 199.6 bits 750,  Expect = 2e-53
 Identities = 106/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHLMCEIEG+ LTSAAIIG+DG+VWAQSA FP FKPEE+  IM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GG+TVKKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQSL 131
            +LGDYLIEQ +
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 41. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 199.1 bits 748,  Expect = 3e-53
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ L+SAAI+G+DG+VWAQS  FPQFKPEE+T I+ DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            AP GL+LG TKYMVIQGE GAVIRGKKG GGITVKKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 42. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 198.8 bits 747,  Expect = 4e-53
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ LTSAAI+G+DG+ WAQS  FP+FKPEE+ AIM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGITVKKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 43. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 198.5 bits 746,  Expect = 5e-53
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVDDHLMCEIEG  N LT+AAI+G DGSVWAQSA FPQFKP+EI+A++ +F E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGEAG VIRGKKGPGGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 44. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 198.5 bits 746,  Expect = 5e-53
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQ YVDDHLMC+IEG+   RLT+AAI+G+DGSVWAQSATFPQFKPEE+  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGEAGAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            + ERLGDYL+EQ L
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 45. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 198.5 bits 746,  Expect = 5e-53
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQ YVDDHLMC+IEG+   RLT+AAI+G+DGSVWAQSATFPQFKPEEI  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            GTLAPTGL+LGGTKYMVIQGEAGAVIRGKKG GGIT+KKTNQAL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            +V RLGD L++Q +
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 46. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 198.0 bits 744,  Expect = 7e-53
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ L SAAI+G+DG+VWAQSA FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGE G VIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 47. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 198.0 bits 744,  Expect = 7e-53
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ L SAAI+G+DG+VWAQSA FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGE G VIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 48. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 198.0 bits 744,  Expect = 7e-53
 Identities = 110/129 85%, Positives = 117/129 90%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQ YVDDHLMCEIEG  N LT AAI+G DGSVWAQSA FPQFKP+EI AI+ DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGE GAVIRGKKG GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQ 129
            VERLGDYLIEQ
Sbjct  121  VERLGDYLIEQ 131

Sequence Alignment: 49. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 197.5 bits 742,  Expect = 1e-52
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDD LMC+I+G+ LT+AAI+G+DGSVWA+S+TFP+FKPEEITAIM DF EPG+L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 197.0 bits 740,  Expect = 1e-52
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ+YVDDHLMC++EGN LT+AAI+GQDGSVWAQSA FPQ+KP+EI  I  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGG KYMVIQGE GAVIRGKKGPGG+T+KKTNQAL+ G YDEPMT GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIE  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 51. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 196.2 bits 737,  Expect = 2e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQTYVDDHLMCE++GN   +L++AAIIG+DGSVWAQS+TFP+FKPEEIT IM +F EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGE  AVIRGKKG GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLIEQSL 131
            IVERLGDYLIEQ L
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 52. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 195.7 bits 735,  Expect = 3e-52
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHL+C+I+G  LT+AAI+G+DGSVWAQS  FPQ KPEEI AIM DF EPG+L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKG GG+T+KKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL +Q +
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 53. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 195.4 bits 734,  Expect = 4e-52
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMCEIEG+ L SAAI G+DG+VWAQSA FPQFKPEEIT IM D+ EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++   KYMVIQGE GAVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 54. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 194.4 bits 730,  Expect = 9e-52
 Identities = 105/131 80%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            M WQTYVDDHLMCEIEG  N L+ AAI+G DGSVWAQSA+FPQFKP+EI A++ DF  PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGE G  IRGKKGPGGI VKKT QAL+ GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 194.2 bits 729,  Expect = 1e-51
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQTYVDDHLMCEI-EGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGT 59
            MSWQ YVDDHLMC++ +GN   SAAIIG+DGSVWAQSA FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIV 119
            LAPTGL+LGGTKYMVIQGE+GAVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQSL 131
            ERLGDYL+EQ L
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 56. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 193.9 bits 728,  Expect = 1e-51
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVD+HLMCEIEG  L++AAI+G+DGSVWAQS +FP++KPEE+  I+ DF EPGTL
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE G VIRGKKG GGIT+KKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 57. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 193.9 bits 728,  Expect = 1e-51
 Identities = 105/131 80%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQ YVDDHLMCE+EGN    LT+AAIIG+DGSVWAQS+TFPQ KPEEI  IM DF EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGE  AVIRGKKG GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLIEQSL 131
            IVERLGDYLI+Q L
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 58. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 193.1 bits 725,  Expect = 2e-51
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVDDHLMC+I+G    L +A+I+G+DGS+WAQSA+FPQ+KPEEIT IM DF EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGLY+ GTKYMVIQGE+GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYLIEQ +
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 59. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 192.4 bits 722,  Expect = 3e-51
 Identities = 99/129 76%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVD+HLMC+++G+ LTSAAI+G+DGSVWAQSA FP++KP EITAI+NDF EPG+L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+Y+ G KYMVIQGE G VIRGKKG GG+T+KK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLIEQ
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 60. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 192.4 bits 722,  Expect = 3e-51
 Identities = 102/129 79%, Positives = 113/129 87%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSW+ YVDDHL CEI+G  LTSAAI+G+DGSVWAQS  FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 61. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 192.4 bits 722,  Expect = 3e-51
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHL+C+IEG  L++AAI+G+DGSVWAQS  FP++KPEE+  ++ DF EPGTL
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE G VIRGKKG GGIT+KKT  +LIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 62. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 191.6 bits 719,  Expect = 6e-51
 Identities = 101/131 77%, Positives = 112/131 85%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHL CEI+G  LTSAAI+G+DG VW QS  FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 63. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 191.1 bits 717,  Expect = 9e-51
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HLMC+I+G    L +AAIIG+DGSVWAQS+ FPQFK EEI+ IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGL+LGGTKYMVIQGEAGAVIRGKKG GG+T+KKT+QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q L
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 64. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 191.0 bits 717,  Expect = 9e-51
 Identities = 101/129 78%, Positives = 113/129 87%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHL CEI+G  LTSAAI+G+DGSVW +S  FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 65. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 191.0 bits 717,  Expect = 9e-51
 Identities = 101/129 78%, Positives = 113/129 87%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVDDHL CEI+G  LTSAAI+G+DGSVWA+S  FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 66. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 190.8 bits 716,  Expect = 1e-50
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCEI-EGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGT 59
            MSWQ YVDDHLMC++ +GN L SAAIIG+DGSVWAQSA FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIV 119
            LAPTGL+LGGTKYMVIQGE+GAVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQSL 131
            ERLGDYL+EQ +
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 67. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 190.8 bits 716,  Expect = 1e-50
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 4/130 3%
Query  1    MSWQTYVDDHLMCEIEG---NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
            MSWQTYVD+HLMC+I+G   N L SA I+G+DGSVWAQS++FPQFKP+EIT IM DF EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGEAGAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  IVERLGDYLIEQSL 131
            +VERLGDYLI+Q L
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 68. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 189.9 bits 712,  Expect = 2e-50
 Identities = 104/109 95%, Positives = 108/109 99%, Gaps = 0/109 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQTYVDDHLMCEIEGN LTSAAIIGQDGS+WAQSA+FPQFKPEEITAIMNDF+EPGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEP 109
            APTGLYLGGTKYMVIQGEAGAVIRGKKGPGG+TVKKTNQALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 69. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 190.0 bits 713,  Expect = 2e-50
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSWQ YVD+HLMCEIEG+ L +AAI+G+DG+ WAQS  FP+FK E++  IM DF EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 190.0 bits 713,  Expect = 2e-50
 Identities = 101/129 78%, Positives = 112/129 86%, Gaps = 0/129 0%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
            MSW+ YVDDHL CEI+G  LTSAAI+G+DGSVWAQS  FPQFKPEE   I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 71. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 185.9 bits 697,  Expect = 3e-49
 Identities = 100/131 76%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIE--GNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQ YVD+HLMC IE  GN LTS+AI+G DGS+WAQS+ FPQ KP+EI AI  +F  P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGG KYMVIQGE GAVIRGKKGPGG+ +KKT QALI GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYLIEQ L
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 185.6 bits 696,  Expect = 4e-49
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVDDHLMC+IEG    LTSAAI G DG+VWA+SA+FP+FKP EI AI+ +F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGL+LGG KYMVIQGEAGAVIRGKKG GGI +KKT QA++ GIYDEP+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q +
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 185.4 bits 695,  Expect = 4e-49
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVDDHLMC+IEG    LT+AAI+G DG+VWA+S  FP+FKPEE+  I+N+F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGG KYMV+QGEAGAVIRGKKG GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q++
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 184.9 bits 693,  Expect = 6e-49
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HLMC+I+G    LT+AAIIG+DGS+WAQS++FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGL+L GTKYMVIQGE GAVIRGKKG GG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q L
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 75. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 181.8 bits 681,  Expect = 5e-48
 Identities = 95/131 72%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
            MSWQ YVD+HLMC+IEG    LTSAAI+G DG+VWAQSA FPQFKPEE+  I+ +F E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTG+++ G KYMV+QGE GAVIRGKKG GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 132.7 bits 491,  Expect = 4e-33
 Identities = 101/129 78%, Positives = 115/129 89%, Gaps = 28/129 21%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQ------------------- 41
            MSWQTYVDDHLMC++EG+ L SAAI+G DGSVWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITAIMNDFAEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGI 92
                     FKPEEIT IM DF EPG LAPTGL+LGGTKYMVIQGE GAVIRGKKG  GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIEQ 129
            T+KKT QALI GIY+EP+TPGQCNM+VE++GDYL++Q
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQ 157

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 79.2 bits 283,  Expect = 4e-17
 Identities = 50/122 40%, Positives = 78/122 63%, Gaps = 8/122 6%
Query  1    MSWQTYVDDHLMCEIEGNRLTSAAIIG-QDGSVWAQ-SATFP-QFKPEEITAIMNDF-AE 56
            MSWQ+YVD+++ C+    RL  A I G QDG+VWA+    +P Q   +E+  I +   + 
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCN 116
            P ++   G++LGG KY+ IQ +  +++RG+KG   + +  TN  L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MIVERLGDYL 126
             +VE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.