The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL
APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE
RLGDYLVDQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL07320 Lit c 1 131 899 243.3 1.6e-66
A0A2I4DNN6 Jug r 7.0101 131 826 224.1 9.7e-61
Q9M7N0 Hev b 8.0201 131 825 223.8 1.2e-60
Q9LEI8 Hev b 8.0204 131 816 221.5 6.1e-60
Q9M7M8 Hev b 8.0203 131 807 219.1 3.1e-59
Q9M7M9 Hev b 8.0202 131 805 218.5 4.5e-59
Q9XF38 Pyr c 4 131 803 218.0 6.5e-59
AAL29690 Lyc e 1 131 795 215.9 2.8e-58
CAD37202 Pru p 4.0201 131 794 215.6 3.4e-58
Q9STB6 Hev b 8.0102 131 794 215.6 3.4e-58
AAL92870 Che a 2 131 793 215.4 4.1e-58
Q9XF41 Mal d 4 131 789 214.3 8.5e-58
O65812 Hev b 8.0101 131 787 213.8 1.2e-57
Q9FUD1 Ory s 12.0101 131 784 213.0 2.1e-57
AF377948 Mus a 1.0101 131 784 213.0 2.1e-57
Q9AXH4 Cor a 2 131 784 213.0 2.1e-57
Q9XF40 Mal d 4 131 783 212.7 2.5e-57
CAD10376 Cap a 2 131 780 212.0 4.4e-57
O65809 Gly m 3 131 779 211.7 5.3e-57
AAK01235 Cor a 2 131 778 211.4 6.3e-57
FM164277 Tri a 12.0104 131 777 211.2 7.6e-57
O65810 Gly m 3 131 776 210.9 9.1e-57
AAK54835 Ana c 1 131 776 210.9 9.1e-57
P35081 Zea m 12.0101 131 776 210.9 9.1e-57
A0A023W2L7 Pro j 2.0101 133 776 210.9 9.2e-57
O04725 Cyn d 12 131 775 210.6 1.1e-56
QVU02258 Que ac 2.0101 133 775 210.6 1.1e-56
O24650 Phl p 12.0102 131 774 210.4 1.3e-56
Q9XF42 Mal d 4 131 773 210.1 1.6e-56
P52184 Hor v 12.0101 131 773 210.1 1.6e-56
P49232 Tri a 12.0101 138 772 209.9 2e-56
P49233 Tri a 12.0102 141 772 209.9 2e-56
AAP13533 Cuc m 2 131 771 209.6 2.3e-56
Q5XWE1 Citr l 2.0101 131 771 209.6 2.3e-56
CAD10377 Lyc e 1 131 770 209.3 2.7e-56
QID21357 Pop n 2.0101 131 770 209.3 2.7e-56
Q8L5D8 Pho d 2.0101 131 770 209.3 2.7e-56
Q93YG7 Sola l 1.0101 131 770 209.3 2.7e-56
CAD37201 Pru p 4.0101 131 769 209.1 3.3e-56
AY081850 Pru du 4.0101 131 768 208.8 3.9e-56
AY081852 Pru du 4.0102 131 768 208.8 3.9e-56
Q9FR39 Zea m 12.0105 131 768 208.8 3.9e-56
A0A0A0REA1 Koc s 2.0101 133 768 208.8 4e-56
CAA54686 Phl p 12.0101 131 767 208.5 4.7e-56
P35079 Phl p 12.0101 131 767 208.5 4.7e-56
ACP43298 Ama r 2.0101 133 767 208.5 4.8e-56
O22655 Zea m 12.0104 131 766 208.3 5.7e-56
P35083 Zea m 12.0103 131 765 208.0 6.8e-56
Q9SQI9 Ara h 5 131 763 207.5 9.8e-56
Q9XF39 Pru av 4 131 762 207.2 1.2e-55
ACS34771 Sal k 4.0101 133 761 206.9 1.4e-55
P49234 Tri a 12.0103 140 760 206.7 1.8e-55
O24282 Phl p 12.0103 131 757 205.9 2.9e-55
XP030492464 Can s 2.0101 133 757 205.9 3e-55
AAL76933 Dau c 4 134 757 205.9 3e-55
Q9XF37 Api g 4 134 757 205.9 3e-55
A0A0A0RCW1 Aca f 2 133 756 205.6 3.6e-55
O49894 Mer a 1 133 753 204.8 6.2e-55
P35082 Zea m 12.0102 131 748 203.5 1.5e-54
P25816 Bet v 2 133 748 203.5 1.5e-54
P84177 Cit s 2.0101 131 746 203.0 2.2e-54
ABU95412 Sin a 4.0101 131 745 202.7 2.6e-54
O24169 Ole e 2 134 743 202.2 3.9e-54
O24170 Ole e 2 134 741 201.7 5.6e-54
O24171 Ole e 2 134 736 200.4 1.4e-53
Q5EF31 Cro s 1.0101 131 733 199.6 2.4e-53
QRN65366 Lig v 2.0101 134 731 199.0 3.5e-53
Q42449 Ara t 8 131 720 196.1 2.6e-52
ADK22841 Sal k 4.0201 133 720 196.1 2.6e-52
Q9XG85 Par j 3 132 713 194.3 9.2e-52
AJ421030 Art v 4.0101 133 706 192.4 3.3e-51
Q9T0M8 Par j 3 131 700 190.8 9.9e-51
O81982 Hel a 2 133 698 190.3 1.4e-50
AJ421031 Art v 4.0201 133 684 186.6 1.9e-49
FG438715 Act d 9.0101 109 645 176.3 2e-46
QEQ43417 Sola m 1.0101 159 514 141.8 6.9e-36
A0A1B2YLJ4 Tyr p 36.0101 131 272 77.9 9.7e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 243.3 bits 899,  Expect = 2e-66
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLVDQGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 2. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 224.1 bits 826,  Expect = 1e-60
 Identities = 119/131 90%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE DGQHLTAAAIIGHDGSVWAQS++FPQFKP EIAAIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG GGITVKKT QALI GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 223.8 bits 825,  Expect = 1e-60
 Identities = 116/131 88%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+ DG+HLTAAAIIGHDGSVWAQS++FPQFKP E+AAIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPGAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 4. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 221.5 bits 816,  Expect = 6e-60
 Identities = 116/131 88%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ DG+ LTAAAIIGHDGSVWAQS++FPQFK  E+AA+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPGAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 5. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 219.1 bits 807,  Expect = 3e-59
 Identities = 114/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ DG+ LTAAAIIGHDGSVWAQS+ FPQFK  E+AA+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPGAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 218.5 bits 805,  Expect = 5e-59
 Identities = 114/131 87%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ DG+ LTAAAIIGHDGSVWAQS++FPQFK  E+AAIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLG TKYMVIQGEPGAVIRGKKG GGITVKKT+QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 218.0 bits 803,  Expect = 7e-59
 Identities = 111/131 84%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG+HLTAAAI+GHDGSVWAQS+ FP+FKP EI AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG GG+TVKKT+QAL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 8. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 215.9 bits 795,  Expect = 3e-58
 Identities = 113/131 86%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ +G HLT+AAIIG+DGSVWAQSANFPQFKP EI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDY+++QGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 9. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 215.6 bits 794,  Expect = 3e-58
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCE +G HL+AAAIIGHDGSVWAQSA FPQ+KP E+  I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGPGG+TVKK+T AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 215.6 bits 794,  Expect = 3e-58
 Identities = 111/130 85%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCE +G HL+AAAIIG+DGSVWAQSANFPQFK  EI  IM DF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKGPGG+TVKKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 11. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 215.4 bits 793,  Expect = 4e-58
 Identities = 108/131 82%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ +G HL++AAI+GHDG+VWAQS +FPQ+KP E++AIMKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGEPG VIRGKKGPGG+T+KKT QALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            R+GDYLV+QG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 12. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 214.3 bits 789,  Expect = 8e-58
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCE +G HL+AAAIIGH+GSVWAQSA FPQ+KP E+  IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGG+TVKK+T AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 213.8 bits 787,  Expect = 1e-57
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+ LMCE +G HLTAAAIIG+DGSVWAQS+NFPQFK  EI AIM DFDEPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKGPGG+TV+KT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 14. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 213.0 bits 784,  Expect = 2e-57
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HLT+AAI+GHDG+VWAQSA FPQFKP E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 15. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 213.0 bits 784,  Expect = 2e-57
 Identities = 112/131 85%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C+ DGQ LTAAAI+GHDGSVWAQS  FPQ KP EIAAIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKT  ALIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL DQG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 16. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 213.0 bits 784,  Expect = 2e-57
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ Y D+HLMCE +G  L AAAIIGHDGSVWAQS+ FPQ+KP EI  +M DF+EPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGPGG+TVKKT+QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 17. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 212.7 bits 783,  Expect = 3e-57
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDD LMC+ DG+HLTAAAI+GHDGSVWA+S+ FP+FKP EI AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGLHLGGTKYMVIQGE GAVIRGKKG GG+TVKKT QAL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 18. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 212.0 bits 780,  Expect = 4e-57
 Identities = 112/131 85%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCE +G  LT+AAIIG+DGSVWAQSA FPQFKP EI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGPGGITVKKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 19. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 211.7 bits 779,  Expect = 5e-57
 Identities = 110/130 84%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C+ +G HLT AAIIG+DGSVWAQS +FPQFKP EI AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQG 130
            R GDYL+DQG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 20. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 211.4 bits 778,  Expect = 6e-57
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTY D+HLMCE +G  L AAAIIGHDGSVWAQS+ FPQ+KP EI  +M DF+EPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIR KKGPGG+TVKKT+QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 21. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 211.2 bits 777,  Expect = 8e-57
 Identities = 109/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSW+ YVDDHL CE DGQHLT+AAI+GHDGSVWAQS NFPQFKP EIA I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 210.9 bits 776,  Expect = 9e-57
 Identities = 110/130 84%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C  +G HLT AAIIG+DGSVW QS +FPQFKP EI AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 23. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 210.9 bits 776,  Expect = 9e-57
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCE DGQHL++AAI+GHD +VWAQS NFPQFKP EI+AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GGITVKKT  ALIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 24. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 210.9 bits 776,  Expect = 9e-57
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HLT+AAI+GHDG+ WAQS  FP+FKP E+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GGITVKKT Q+LIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 25. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 210.9 bits 776,  Expect = 9e-57
 Identities = 111/131 84%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVDDHLMCE +G   HL+AAAI+G DGSVWAQSA+FPQFKP EI+A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGEPG VIRGKKGPGGI VKKT QALIIGIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 26. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 210.6 bits 775,  Expect = 1e-56
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCE +G+HLT+AAIIGHDG+VWAQSA FP FKP E+A IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLVDQGL 131
            +LGDYL++QG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 27. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 210.6 bits 775,  Expect = 1e-56
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDGQ--HLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVD+HLMC+ DGQ  HL AAAIIGHDGSVWAQS+NFPQFK  EI+ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
             LAPTGLHLGGTKYMVIQGE GAVIRGKKG GG+T+KKT+QAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLVDQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 28. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 210.4 bits 774,  Expect = 1e-56
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HL +AAI+GHDG+VWAQSA+FPQFKP EI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 29. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 210.1 bits 773,  Expect = 2e-56
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA+FP FKP EIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GGIT+KKT+QAL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 30. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 210.1 bits 773,  Expect = 2e-56
 Identities = 109/131 83%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHL CE DGQHLT+AAI+GHDG VW QS NFPQFKP EIA I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT   LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 31. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 209.9 bits 772,  Expect = 2e-56
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHL CE DGQHLT+AAI+GHDGSVW +S NFP+FKP EIA I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 32. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 209.9 bits 772,  Expect = 2e-56
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL CE DGQHLT+AAI+GHDGSVWA+S NFP+FKP EIA I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 209.6 bits 771,  Expect = 2e-56
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLMCE +G HLT+AAIIG+DGSVWAQS NFPQ+KP E+A I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKGPGG+TVKKT  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 34. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 209.6 bits 771,  Expect = 2e-56
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCE +G HLT+AAIIG+DGSVWA+S NFPQ+KP EI  I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GG+KYMVIQGEPGAVIRGKKGPGG+TVKKT  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 209.3 bits 770,  Expect = 3e-56
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HL+CE +G HLT+AAIIG+DG+VWAQSANFPQFKP EI  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKGPGGIT+KKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 36. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 209.3 bits 770,  Expect = 3e-56
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ +G  LT+AAIIGHDGSVWA SA+FPQF   E++AIMKDF+EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKKT QALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 37. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 209.3 bits 770,  Expect = 3e-56
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLMCE DG+HLTAAAI+GHDGSVWAQS++FPQFK  EI  IM DF+EPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QALI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 38. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 209.3 bits 770,  Expect = 3e-56
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HL+CE +G HLT+AAIIG+DG+VWAQSANFPQFKP EI  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKGPGGIT+KKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 39. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 209.1 bits 769,  Expect = 3e-56
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA FP FKP EIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 40. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 208.8 bits 768,  Expect = 4e-56
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA FP FKP EIAAI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 208.8 bits 768,  Expect = 4e-56
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA FP FKP EIAAI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 42. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 208.8 bits 768,  Expect = 4e-56
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C+ +GQHL+AAAI+GHDGSVWAQS NFP++KP E+A ++KDFDEPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG GGIT+KKT  +LIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 43. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 208.8 bits 768,  Expect = 4e-56
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVDDHLMC+ +G   HLT AAI+G DGSVWAQSANFPQFKP EIAAI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKGPGGI VKKT QALI GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 44. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 208.5 bits 767,  Expect = 5e-56
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HL +AAI+GHDG+VWAQSA+FPQFKP EI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 45. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 208.5 bits 767,  Expect = 5e-56
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HL +AAI+GHDG+VWAQSA+FPQFKP EI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 46. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 208.5 bits 767,  Expect = 5e-56
 Identities = 109/130 83%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQ YVDDHLMCE +G   HLT AAI+G DGSVWAQSA+FPQFKP EIAAI++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGEPGAVIRGKKG GGI VKKT QAL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 47. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 208.3 bits 766,  Expect = 6e-56
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLMCE +GQHL+AAAI+GHDGSVWAQS +FP++KP E+A I+KDFDEPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG GGIT+KKT  +LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 48. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 208.0 bits 765,  Expect = 7e-56
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HL++AAI+GHDG+VWAQS  FPQFKP E+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKG GGITVKKT QAL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 49. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 207.5 bits 763,  Expect = 1e-55
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HL+CE +G HL++AAI+G+DG VWAQS++FPQFKP EI AIM DF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKGPGG+T++KT QALIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL+D GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 50. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 207.2 bits 762,  Expect = 1e-55
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA FP FKP EIAAI+KD+D+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGITVKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 51. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 206.9 bits 761,  Expect = 1e-55
 Identities = 110/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVDDHLMCE +G   HLTAAAI+G DGSVWAQSANFPQFKP EI+A++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGE G VIRGKKGPGGI VKKT QALI GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 52. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 206.7 bits 760,  Expect = 2e-55
 Identities = 107/130 82%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSW+ YVDDHL CE DGQ+LT+AAI+GHDGSVWAQS NFPQFKP E A I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 53. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 205.9 bits 757,  Expect = 3e-55
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCE +G+HL +AAI GHDG+VWAQSA+FPQFKP EI  IMKD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTG+ +   KYMVIQGEPGAVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 54. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 205.9 bits 757,  Expect = 3e-55
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDGQ--HLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVD+HLMC+ DGQ  HLTAAAIIGHDGS+WAQS++FPQ+K  EI  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
             LAPTGLHL GTKYMVIQGEPGAVIRGKKG GG+T+KKT QALI GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLVDQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 55. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 205.9 bits 757,  Expect = 3e-55
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCETDG---QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
            MSWQTYVDDHLMCE DG   Q+L+AAAIIGHDGSVWAQS+ FP+FKP EI  IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGEP AVIRGKKG GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLVDQGL 131
            +VERLGDYL++QGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 56. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 205.9 bits 757,  Expect = 3e-55
 Identities = 107/131 81%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCETDG---QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
            MSWQ YVDDHLMCE +G   Q LTAAAIIGHDGSVWAQS+ FPQ KP EIA IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGEP AVIRGKKG GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLVDQGL 131
            +VERLGDYL+DQGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 57. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 205.6 bits 756,  Expect = 4e-55
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            M WQTYVDDHLMCE +G   HL+ AAI+G DGSVWAQSA+FPQFKP EIAA++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGLHLGGTKYMVIQGEPG  IRGKKGPGGI VKKT QAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 58. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 204.8 bits 753,  Expect = 6e-55
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDGQ--HLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVDDHLMC+ DGQ  HL AA+I+GHDGS+WAQSA+FPQ+KP EI  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
             LAPTGL++ GTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 59. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 203.5 bits 748,  Expect = 2e-54
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVD+HLMCE +G+HL AAAI+GHDG+ WAQS  FP+FK  ++A IMKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 60. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 203.5 bits 748,  Expect = 2e-54
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDGQ--HLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVD+HLMC+ DGQ  +  A+AI+GHDGSVWAQS++FPQFKP EI  IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
             LAPTGLHLGG KYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYL+DQGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 61. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 203.0 bits 746,  Expect = 2e-54
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+ DG  LTAAAI+G+DGSVW+QSA FP F+  EIAAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGI VKKT QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 62. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 202.7 bits 745,  Expect = 3e-54
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ +G  LTAAAI+G+DGSVWAQSANFPQ+KP EI  I  DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEP AVIRGKKG GG+T+KKTTQA++ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 63. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 202.2 bits 743,  Expect = 4e-54
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCETDGQH---LTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
            MSWQ YVDDHLMC+ +G+    LTAAAI+GHDGSVWAQSA FPQFKP E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVDQGL 131
            VVERLGDYLV+QG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 64. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 201.7 bits 741,  Expect = 6e-54
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCETDGQH---LTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
            MSWQ YVDDHLMC+ +G+    LTAAAI+GHDGSVWAQSA FPQFKP E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVDQGL 131
            VVERLGDYL++QGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 65. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 200.4 bits 736,  Expect = 1e-53
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCETDGQH---LTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
            MSWQ YVDDHLMC+ +G+    LTAAAI+GHDGSVWAQSA FPQFKP E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVDQGL 131
            V ERLGDYL++QGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 66. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 199.6 bits 733,  Expect = 2e-53
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+ DG+ LT+AAI+GHDGSVWAQSA FP++KPAEI AI+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KK+  ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 67. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 199.0 bits 731,  Expect = 3e-53
 Identities = 105/131 80%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCETDGQH---LTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
            MSWQ YVDDHLMC+ +G+    LTAAAI+GHDGSVWAQSA FPQFKP EI  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
            G+LAPTGLHLGGTKYMVIQGE GAVIRGKKG GGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVDQGL 131
            VV RLGD LV QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 68. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 196.1 bits 720,  Expect = 3e-52
 Identities = 101/131 77%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQ+YVDDHLMC+ +G HLTAAAI+G+DGSVWAQSA FPQ+KP EI  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGG KYMVIQGE GAVIRGKKGPGG+T+KKT QAL+ G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLVDQGL 131
            RLGDYL++  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 69. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 196.1 bits 720,  Expect = 3e-52
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMC--ETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQ YVD+HLMC  E  G HLT++AI+G DGS+WAQS+NFPQ KP EI AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGL LGG KYMVIQGEPGAVIRGKKGPGG+ +KKTTQALI GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 70. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 194.3 bits 713,  Expect = 9e-52
 Identities = 103/131 78%, Positives = 114/131 87%, Gaps = 1/131 0%
Query  1    MSWQTYVDDHLMCET-DGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGS 59
            MSWQ YVDDHLMC+  DG    +AAIIGHDGSVWAQSANFPQ+KP E+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVV 119
            LAPTGL LGGTKYMVIQGE GAVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLVDQGL 131
            ERLGDYL++QGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 71. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 192.4 bits 706,  Expect = 3e-51
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVDDHLMC+ +G  QHLT+AAI G DG+VWA+SA+FP+FKP EI AI+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
             LAPTGL LGG KYMVIQGE GAVIRGKKG GGI +KKT QA++ GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYL+DQG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 72. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 190.8 bits 700,  Expect = 1e-50
 Identities = 102/130 78%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCET-DGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGS 59
            MSWQ YVDDHLMC+  DG  L +AAIIGHDGSVWAQSANFPQ+KP E+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLVDQGL 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 73. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 190.3 bits 698,  Expect = 1e-50
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQ YVD+HLMC+ +G  QHLT+AAI+G DG+VWAQSA FPQFKP E+  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTG+ + G KYMV+QGEPGAVIRGKKG GGI +KKT QA+I+GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 186.6 bits 684,  Expect = 2e-49
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
            MSWQTYVDDHLMC+ +G  QHLTAAAI+G DG+VWA+S  FP+FKP E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
            +LAPTGL LGG KYMV+QGE GAVIRGKKG GGI +KKT QA+++GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLVDQGL 131
            VERLGDYLVDQ +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 176.3 bits 645,  Expect = 2e-46
 Identities = 92/109 84%, Positives = 101/109 92%, Gaps = 0/109 0%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCE +G +LT+AAIIG+DGS+WAQSA+FPQFKP EI AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEP 109
            APTGL+LGGTKYMVIQGE GAVIRGKKGPGG+TVKKT QALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 141.8 bits 514,  Expect = 7e-36
 Identities = 105/130 80%, Positives = 116/130 89%, Gaps = 28/130 21%
Query  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQ------------------- 41
            MSWQTYVDDHLMC+ +G+HL +AAI+G DGSVWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPAEIAAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGI 92
                     FKP EI  IMKDFDEPG LAPTGL LGGTKYMVIQGEPGAVIRGKKG  GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTTQALIIGIYDEPMTPGQCNMVVERLGDYLVDQG 130
            T+KKT QALI GIY+EP+TPGQCNMVVE++GDYLVDQG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 77.9 bits 272,  Expect = 1e-16
 Identities = 51/120 42%, Positives = 75/120 62%, Gaps = 12/120 10%
Query  1    MSWQTYVDDHLMCETDGQHLTA--AAIIG-HDGSVWAQ-SANFP-QFKPAEIAAIMKDF- 54
            MSWQ+YVD+++ C    QH+    A I G +DG+VWA+   ++P Q    E+  I     
Sbjct  1    MSWQSYVDNQI-C----QHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  55   DEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQ 114
              P S+   G+HLGG KY+ IQ +  +++RG+KG   + +  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  115  CNMVVERLGDYL 126
             N VVE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.