The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL
APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE
RLGDYLIEQSL
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD10377 Lyc e 1 131 886 223.1 1.9e-60
Q93YG7 Sola l 1.0101 131 886 223.1 1.9e-60
CAD10376 Cap a 2 131 813 205.3 4.3e-55
AAL29690 Lyc e 1 131 801 202.4 3.2e-54
Q9STB6 Hev b 8.0102 131 795 201.0 8.9e-54
AAP13533 Cuc m 2 131 787 199.0 3.4e-53
Q5XWE1 Citr l 2.0101 131 786 198.8 4.1e-53
Q9SQI9 Ara h 5 131 775 196.1 2.6e-52
CAD37202 Pru p 4.0201 131 774 195.9 3.1e-52
O65812 Hev b 8.0101 131 772 195.4 4.3e-52
Q9AXH4 Cor a 2 131 770 194.9 6e-52
AAL07320 Lit c 1 131 770 194.9 6e-52
Q9XF41 Mal d 4 131 769 194.6 7.2e-52
O65809 Gly m 3 131 769 194.6 7.2e-52
O65810 Gly m 3 131 766 193.9 1.2e-51
AAK01235 Cor a 2 131 764 193.4 1.7e-51
Q9FUD1 Ory s 12.0101 131 762 192.9 2.3e-51
ABU95412 Sin a 4.0101 131 762 192.9 2.3e-51
O24650 Phl p 12.0102 131 759 192.2 3.9e-51
AAL92870 Che a 2 131 755 191.2 7.6e-51
CAA54686 Phl p 12.0101 131 752 190.5 1.3e-50
P35079 Phl p 12.0101 131 752 190.5 1.3e-50
Q9M7N0 Hev b 8.0201 131 750 190.0 1.8e-50
Q8L5D8 Pho d 2.0101 131 748 189.5 2.5e-50
AAK54835 Ana c 1 131 747 189.3 2.9e-50
A0A2I4DNN6 Jug r 7.0101 131 742 188.1 6.8e-50
O24282 Phl p 12.0103 131 742 188.1 6.8e-50
P35083 Zea m 12.0103 131 739 187.3 1.1e-49
O04725 Cyn d 12 131 735 186.4 2.2e-49
CAD37201 Pru p 4.0101 131 734 186.1 2.6e-49
AY081850 Pru du 4.0101 131 733 185.9 3.1e-49
AY081852 Pru du 4.0102 131 733 185.9 3.1e-49
A0A023W2L7 Pro j 2.0101 133 733 185.9 3.2e-49
P35081 Zea m 12.0101 131 732 185.6 3.7e-49
QID21357 Pop n 2.0101 131 731 185.4 4.3e-49
Q9XF42 Mal d 4 131 730 185.1 5.1e-49
Q9XF39 Pru av 4 131 727 184.4 8.5e-49
O22655 Zea m 12.0104 131 726 184.2 1e-48
Q9FR39 Zea m 12.0105 131 724 183.7 1.4e-48
AAL76933 Dau c 4 134 723 183.4 1.7e-48
P52184 Hor v 12.0101 131 722 183.2 2e-48
FM164277 Tri a 12.0104 131 722 183.2 2e-48
ACP43298 Ama r 2.0101 133 721 183.0 2.4e-48
Q42449 Ara t 8 131 720 182.7 2.8e-48
Q9M7M8 Hev b 8.0203 131 719 182.5 3.3e-48
Q9LEI8 Hev b 8.0204 131 718 182.2 3.9e-48
P49232 Tri a 12.0101 138 717 182.0 4.9e-48
P49233 Tri a 12.0102 141 717 182.0 5e-48
Q9XF38 Pyr c 4 131 715 181.5 6.5e-48
A0A0A0REA1 Koc s 2.0101 133 715 181.5 6.6e-48
Q9M7M9 Hev b 8.0202 131 714 181.3 7.6e-48
Q9XF37 Api g 4 134 713 181.0 9.3e-48
P84177 Cit s 2.0101 131 711 180.5 1.3e-47
A0A0A0RCW1 Aca f 2 133 711 180.5 1.3e-47
ACS34771 Sal k 4.0101 133 710 180.3 1.5e-47
AF377948 Mus a 1.0101 131 707 179.6 2.5e-47
Q9XG85 Par j 3 132 705 179.1 3.5e-47
O24170 Ole e 2 134 705 179.1 3.6e-47
P49234 Tri a 12.0103 140 705 179.0 3.8e-47
P35082 Zea m 12.0102 131 704 178.8 4.1e-47
Q5EF31 Cro s 1.0101 131 703 178.6 4.9e-47
O49894 Mer a 1 133 703 178.6 5e-47
QVU02258 Que ac 2.0101 133 702 178.3 5.9e-47
ADK22841 Sal k 4.0201 133 702 178.3 5.9e-47
O24169 Ole e 2 134 702 178.3 5.9e-47
O24171 Ole e 2 134 700 177.8 8.3e-47
Q9XF40 Mal d 4 131 698 177.4 1.1e-46
QRN65366 Lig v 2.0101 134 697 177.1 1.4e-46
Q9T0M8 Par j 3 131 692 175.9 3.1e-46
P25816 Bet v 2 133 687 174.7 7.4e-46
O81982 Hel a 2 133 687 174.7 7.4e-46
XP030492464 Can s 2.0101 133 687 174.7 7.4e-46
AJ421031 Art v 4.0201 133 674 171.5 6.6e-45
FG438715 Act d 9.0101 109 661 168.4 4.7e-44
AJ421030 Art v 4.0101 133 660 168.1 7e-44
QEQ43417 Sola m 1.0101 159 484 125.2 6.7e-31
A0A1B2YLJ4 Tyr p 36.0101 131 277 74.9 7.8e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 223.1 bits 886,  Expect = 2e-60
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQSL
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 2. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 223.1 bits 886,  Expect = 2e-60
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQSL
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 3. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 205.3 bits 813,  Expect = 4e-55
 Identities = 120/131 91%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+CE EGN LTSAAIIGQDG+VWAQSA FPQFKPEEIT IMNDFA PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE  AVIRGKKGPGGIT+KKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQSL
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 4. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 202.4 bits 801,  Expect = 3e-54
 Identities = 117/131 89%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+C+ EGNHLTSAAIIGQDG+VWAQSANFPQFKPEEIT IMNDFA PGTL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGIT+KKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDY+IEQ L
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 5. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 201.0 bits 795,  Expect = 9e-54
 Identities = 113/129 87%, Positives = 123/129 95%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+CE EGNHL++AAIIGQDG+VWAQSANFPQFK EEITGIM+DF  PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEP AVIRGKKGPGG+T+KKTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 6. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 199.0 bits 787,  Expect = 3e-53
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVDEHL+CE EGNHLTSAAIIGQDG+VWAQS NFPQ+KPEE+ GI+ DFA PGTL
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEP AVIRGKKGPGG+T+KKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 7. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 198.8 bits 786,  Expect = 4e-53
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+CE EGNHLTSAAIIGQDG+VWA+S NFPQ+KPEEITGI+NDF  PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLY+GG+KYMVIQGEP AVIRGKKGPGG+T+KKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 8. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 196.1 bits 775,  Expect = 3e-52
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD HLLCE EG+HL+SAAI+GQDG VWAQS++FPQFKPEEIT IMNDFA PG+L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP A+I GKKGPGG+TI+KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 9. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 195.9 bits 774,  Expect = 3e-52
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+CE EGNHL++AAIIG+DG+VWAQSA FPQ+KPEE+TGI+NDF  PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KK+  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 195.4 bits 772,  Expect = 4e-52
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDE L+CE EGNHLT+AAIIGQDG+VWAQS+NFPQFK EEIT IM+DF  PGTL
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKGPGG+T++KTNQALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 11. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 194.9 bits 770,  Expect = 6e-52
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ Y DEHL+CE EGN L +AAIIG+DG+VWAQS+ FPQ+KPEEITG+MNDF  PG+L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT+QALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 12. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 194.9 bits 770,  Expect = 6e-52
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+CE +G HLT+AAIIG+DG+VWAQSANFPQFKP EI  IM DF  PG+L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKGPGGIT+KKT QALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 13. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 194.6 bits 769,  Expect = 7e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+CE EGNHL++AAIIG++G+VWAQSA FPQ+KPEE+TGIMNDF  PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP  VIRGKKGPGG+T+KK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 14. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 194.6 bits 769,  Expect = 7e-52
 Identities = 109/129 84%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HLLC+ EGNHLT AAIIGQDG+VWAQS +FPQFKPEEIT IMNDF  PG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQ 129
            R GDYLI+Q
Sbjct  121  RPGDYLIDQ 129

Sequence Alignment: 15. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 193.9 bits 766,  Expect = 1e-51
 Identities = 109/129 84%, Positives = 117/129 90%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HLLC  EGNHLT AAIIGQDG+VW QS +FPQFKPEEIT IMNDF  PG+L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 16. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 193.4 bits 764,  Expect = 2e-51
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTY DEHL+CE EGN L +AAIIG+DG+VWAQS+ FPQ+KPEEITG+MNDF  PG+L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP AVIR KKGPGG+T+KKT+QALIIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 17. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 192.9 bits 762,  Expect = 2e-51
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HLTSAAI+G+DGTVWAQSA FPQFKPEE+T IM DF  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 18. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 192.9 bits 762,  Expect = 2e-51
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+C+ EGN LT+AAI+GQDG+VWAQSANFPQ+KPEEI GI NDFA PGTL
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEP AVIRGKKG GG+TIKKT QA++ GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 19. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 192.2 bits 759,  Expect = 4e-51
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HL SAAI+G+DGTVWAQSA+FPQFKPEEITGIM DF  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEP AVIRGKKG GGITIKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 20. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 191.2 bits 755,  Expect = 8e-51
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+C+ EGNHL+SAAI+G+DGTVWAQS +FPQ+KPEE++ IM DF  PG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKGPGG+TIKKTNQALIIGIY EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            R+GDYL+EQ +
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 21. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 190.5 bits 752,  Expect = 1e-50
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HL SAAI+G+DGTVWAQSA+FPQFKPEEITGIM DF  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEP  VIRGKKG GGITIKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 22. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 190.5 bits 752,  Expect = 1e-50
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HL SAAI+G+DGTVWAQSA+FPQFKPEEITGIM DF  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEP  VIRGKKG GGITIKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 23. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 190.0 bits 750,  Expect = 2e-50
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+C+ +G+HLT+AAIIG+DG+VWAQS++FPQFKPEE+  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GGIT+KKT QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 24. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 189.5 bits 748,  Expect = 2e-50
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVDEHL+CE +G+HLT+AAI+G+DG+VWAQS++FPQFK EEIT IMNDF  PG+L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLG TKYMVIQGEP AVIRGKKG GG+T+KKTNQALI GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 25. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 189.3 bits 747,  Expect = 3e-50
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+CE +G HL+SAAI+G+D TVWAQS NFPQFKPEEI+ I+NDF  PG+L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP  VIRGKKG GGIT+KKTN ALIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 26. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 188.1 bits 742,  Expect = 7e-50
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE +G HLT+AAIIG+DG+VWAQS++FPQFKPEEI  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGIT+KKT QALI GIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 27. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 188.1 bits 742,  Expect = 7e-50
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HL SAAI G+DGTVWAQSA+FPQFKPEEITGIM D+  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+++   KYMVIQGEP AVIRGKKG GGITIKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 28. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 187.3 bits 739,  Expect = 1e-49
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HL+SAAI+G+DG VWAQS  FPQFKPEE+T I+ DF  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            AP GL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 29. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 186.4 bits 735,  Expect = 2e-49
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+CE EG+HLTSAAIIG+DGTVWAQSA FP FKPEE+  IM DF  PG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GG+T+KKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQSL 131
            +LGDYLIEQ +
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 30. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 186.1 bits 734,  Expect = 3e-49
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP FKPEEI  I+ DF  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGIT+KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 185.9 bits 733,  Expect = 3e-49
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP FKPEEI  I+ DF  PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGIT+KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 32. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 185.9 bits 733,  Expect = 3e-49
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP FKPEEI  I+ DF  PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGIT+KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 185.9 bits 733,  Expect = 3e-49
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVD+HL+CE EG  NHL++AAI+G DG+VWAQSA+FPQFKP+EI+ ++ DF  PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGEP  VIRGKKGPGGI +KKT QALIIGIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 34. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 185.6 bits 732,  Expect = 4e-49
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+CE EG+HLTSAAI+G+DG  WAQS  FP+FKPEE+  IM DF  PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL LGGTKYMVIQGEP AVIRGKKG GGIT+KKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 35. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 185.4 bits 731,  Expect = 4e-49
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ EGN LTSAAIIG+DG+VWA SA+FPQF  EE++ IM DF  PG+L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GG+T+KKTNQALIIG+YDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 185.1 bits 730,  Expect = 5e-49
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA+FP FKPEEI  I+ DF  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GGITIKKT+QAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 184.4 bits 727,  Expect = 9e-49
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP FKPEEI  I+ D+  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGIT+KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 184.2 bits 726,  Expect = 1e-48
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVDEHL+CE EG HL++AAI+G+DG+VWAQS +FP++KPEE+ GI+ DF  PGTL
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEP  VIRGKKG GGITIKKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 39. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 183.7 bits 724,  Expect = 1e-48
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HLLC+ EG HL++AAI+G+DG+VWAQS NFP++KPEE+ G++ DF  PGTL
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEP  VIRGKKG GGITIKKT  +LIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 40. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 183.4 bits 723,  Expect = 2e-48
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLLCENEGN---HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQTYVD+HL+CE +GN   +L++AAIIG+DG+VWAQS+ FP+FKPEEITGIM +F  P
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP AVIRGKKG GG+TIKKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLIEQSL 131
            IVERLGDYLIEQ L
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 41. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 183.2 bits 722,  Expect = 2e-48
 Identities = 102/131 77%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL CE +G HLTSAAI+G+DG VW QS NFPQFKPEEI GI+ DF  PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 42. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 183.2 bits 722,  Expect = 2e-48
 Identities = 102/129 79%, Positives = 114/129 88%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSW+ YVD+HL CE +G HLTSAAI+G+DG+VWAQS NFPQFKPEEI GI+ DF  PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 43. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 183.0 bits 721,  Expect = 2e-48
 Identities = 104/129 80%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQ YVD+HL+CE EG  NHLT AAI+G DG+VWAQSA+FPQFKP+EI  I+ DF  PG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGEP AVIRGKKG GGI +KKT QAL++GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQ 129
            VERLGDYLIEQ
Sbjct  121  VERLGDYLIEQ 131

Sequence Alignment: 44. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 182.7 bits 720,  Expect = 3e-48
 Identities = 101/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ+YVD+HL+C+ EGNHLT+AAI+GQDG+VWAQSA FPQ+KP+EI GI  DF  PG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGG KYMVIQGE  AVIRGKKGPGG+TIKKTNQAL+ G YDEPMT GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIE  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 45. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 182.5 bits 719,  Expect = 3e-48
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+C+ +G+ LT+AAIIG+DG+VWAQS+ FPQFK +E+  +M DF  PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GGIT+KKT QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 46. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 182.2 bits 718,  Expect = 4e-48
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+C+ +G+ LT+AAIIG+DG+VWAQS++FPQFK +E+  +M DF  PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP AVIRGKKG GGIT+KKT QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL++Q L
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 47. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 182.0 bits 717,  Expect = 5e-48
 Identities = 101/129 78%, Positives = 114/129 88%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL CE +G HLTSAAI+G+DG+VW +S NFP+FKPEEI GI+ DF  PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 48. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 182.0 bits 717,  Expect = 5e-48
 Identities = 101/129 78%, Positives = 114/129 88%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL CE +G HLTSAAI+G+DG+VWA+S NFP+FKPEEI GI+ DF  PG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 49. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 181.5 bits 715,  Expect = 6e-48
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +G+HLT+AAI+G+DG+VWAQS+ FP+FKPEEIT IM DF  PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GG+T+KKT+QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 181.5 bits 715,  Expect = 7e-48
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVD+HL+C+ EG  NHLT AAI+G DG+VWAQSANFPQFKP+EI  I+ +F  PG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGE   VIRGKKGPGGI +KKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 51. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 181.3 bits 714,  Expect = 8e-48
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+C+ +G+ LT+AAIIG+DG+VWAQS++FPQFK +E+  IM DF  PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 52. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 181.0 bits 713,  Expect = 9e-48
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLLCENEGNH---LTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQ YVD+HL+CE EGN    LT+AAIIG+DG+VWAQS+ FPQ KPEEI GIM DF  P
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GG+TIKKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLIEQSL 131
            IVERLGDYLI+Q L
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 53. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 180.5 bits 711,  Expect = 1e-47
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HL+C+ +GN LT+AAI+GQDG+VW+QSA FP F+ EEI  I+ DF  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GGI +KKTNQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 54. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 180.5 bits 711,  Expect = 1e-47
 Identities = 100/131 76%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            M WQTYVD+HL+CE EG  NHL+ AAI+G DG+VWAQSA+FPQFKP+EI  ++ DF  PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGEP   IRGKKGPGGI +KKT QAL+ GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 180.3 bits 710,  Expect = 2e-47
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVD+HL+CE EG  NHLT+AAI+G DG+VWAQSANFPQFKP+EI+ ++ +F   G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGGTKYMVIQGE   VIRGKKGPGGI +KKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 56. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 179.6 bits 707,  Expect = 2e-47
 Identities = 101/131 77%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+HLLC+ +G  LT+AAI+G+DG+VWAQS  FPQ KPEEI  IM DF  PG+L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKG GG+TIKKTN ALIIGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL +Q +
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 57. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 179.1 bits 705,  Expect = 4e-47
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQTYVDEHLLCE-NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGT 59
            MSWQ YVD+HL+C+  +GN   SAAIIG+DG+VWAQSANFPQ+KPEE+TGIMNDF   G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIV 119
            LAPTGL+LGGTKYMVIQGE  AVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQSL 131
            ERLGDYL+EQ L
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 58. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 179.1 bits 705,  Expect = 4e-47
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLLCE---NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQ YVD+HL+C+   +EG+ LT+AAI+G+DG+VWAQSA FPQFKPEE+ GIM DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            +VERLGDYL+EQ L
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 59. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 179.0 bits 705,  Expect = 4e-47
 Identities = 100/129 77%, Positives = 113/129 87%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSW+ YVD+HL CE +G +LTSAAI+G+DG+VWAQS NFPQFKPEE  GI+ DF  PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIDQ 129

Sequence Alignment: 60. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 178.8 bits 704,  Expect = 4e-47
 Identities = 97/131 74%, Positives = 112/131 85%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVDEHL+CE EG+HL +AAI+G+DG  WAQS  FP+FK E++  IM DF  PG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 61. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 178.6 bits 703,  Expect = 5e-47
 Identities = 97/129 75%, Positives = 115/129 89%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVDEHL+C+ +G+ LTSAAI+G+DG+VWAQSA FP++KP EIT I+NDF  PG+L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTG+Y+ G KYMVIQGEP  VIRGKKG GG+TIKK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLIEQ
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 62. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 178.6 bits 703,  Expect = 5e-47
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVD+HL+C+   +G HL +A+I+G+DG++WAQSA+FPQ+KPEEITGIM DF  PG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGLY+ GTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYLIEQ +
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 63. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 178.3 bits 702,  Expect = 6e-47
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVDEHL+C+   +G HL +AAIIG+DG+VWAQS+NFPQFK EEI+ IM DF  PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGL+LGGTKYMVIQGE  AVIRGKKG GG+TIKKT+QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q L
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 64. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 178.3 bits 702,  Expect = 6e-47
 Identities = 100/131 76%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLC--ENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQ YVDEHL+C  E+ GNHLTS+AI+G DG++WAQS+NFPQ KP+EI  I  +F  P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGG KYMVIQGEP AVIRGKKGPGG+ IKKT QALI GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYLIEQ L
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 65. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 178.3 bits 702,  Expect = 6e-47
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLLCENEG--NH-LTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQ YVD+HL+C+ EG  +H LT+AAI+G+DG+VWAQSA FPQFKPEE+ GIM DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            +VERLGDYL+EQ +
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 66. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 177.8 bits 700,  Expect = 8e-47
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLLCE---NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQ YVD+HL+C+   +EG+ LT+AAI+G+DG+VWAQSA FPQFKPEE+ GIM DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            + ERLGDYL+EQ L
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 67. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 177.4 bits 698,  Expect = 1e-46
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQ YVD+ L+C+ +G+HLT+AAI+G+DG+VWA+S+ FP+FKPEEIT IM DF  PG+L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE  AVIRGKKG GG+T+KKT QAL+ GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQSL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 68. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 177.1 bits 697,  Expect = 1e-46
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLLCENEG--NH-LTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQ YVD+HL+C+ EG  +H LT+AAI+G+DG+VWAQSA FPQFKPEEI GIM DF  P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            GTLAPTGL+LGGTKYMVIQGE  AVIRGKKG GGITIKKTNQAL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIEQSL 131
            +V RLGD L++Q +
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 69. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 175.9 bits 692,  Expect = 3e-46
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLLCE-NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGT 59
            MSWQ YVD+HL+C+  +GN L SAAIIG+DG+VWAQSANFPQ+KPEE+TGIMNDF   G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIV 119
            LAPTGL+LGGTKYMVIQGE  AVI GKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQSL 131
            ERLGDYL+EQ +
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 174.7 bits 687,  Expect = 7e-46
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 4/130 3%
Query  1    MSWQTYVDEHLLCENEG---NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
            MSWQTYVDEHL+C+ +G   N L SA I+G+DG+VWAQS++FPQFKP+EITGIM DF  P
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGE  AVIRGKKG GGITIKKT QAL+ GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  IVERLGDYLIEQSL 131
            +VERLGDYLI+Q L
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 71. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 174.7 bits 687,  Expect = 7e-46
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQ YVDEHL+C+ EG   HLTSAAI+G DGTVWAQSA FPQFKPEE+ GI+ +F   G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTG+++ G KYMV+QGEP AVIRGKKG GGI IKKT QA+I+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL+EQ +
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 72. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 174.7 bits 687,  Expect = 7e-46
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVDEHL+C+   +G HLT+AAIIG+DG++WAQS++FPQ+K +EIT I  DF  PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGL+L GTKYMVIQGEP AVIRGKKG GG+TIKKT QALI GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q L
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 171.5 bits 674,  Expect = 7e-45
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVD+HL+C+ EG   HLT+AAI+G DGTVWA+S  FP+FKPEE+ GI+N+F   G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
            TLAPTGL+LGG KYMV+QGE  AVIRGKKG GGI IKKT QA+++GIYDEP+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q++
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 168.4 bits 661,  Expect = 5e-44
 Identities = 95/109 87%, Positives = 104/109 95%, Gaps = 0/109 0%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
            MSWQTYVD+HL+CE EGN+LTSAAIIGQDG++WAQSA+FPQFKPEEIT IMNDF+ PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEP 109
            APTGLYLGGTKYMVIQGE  AVIRGKKGPGG+T+KKTNQALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 75. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 168.1 bits 660,  Expect = 7e-44
 Identities = 94/131 71%, Positives = 110/131 83%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
            MSWQTYVD+HL+C+ EG   HLTSAAI G DGTVWA+SA+FP+FKP EI  I+ +F   G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
             LAPTGL+LGG KYMVIQGE  AVIRGKKG GGI IKKT QA++ GIYDEP+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQSL 131
            VERLGDYL++Q +
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 125.2 bits 484,  Expect = 7e-31
 Identities = 99/129 76%, Positives = 114/129 88%, Gaps = 28/129 21%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQ------------------- 41
            MSWQTYVD+HL+C+ EG+HL SAAI+G DG+VWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITGIMNDFAVPGTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGI 92
                     FKPEEIT IM DF  PG LAPTGL+LGGTKYMVIQGEP AVIRGKKG  GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIEQ 129
            TIKKT QALI GIY+EP+TPGQCNM+VE++GDYL++Q
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQ 157

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.9 bits 277,  Expect = 8e-16
 Identities = 50/122 40%, Positives = 77/122 63%, Gaps = 8/122 6%
Query  1    MSWQTYVDEHLLCENEGNHLTSAAIIG-QDGTVWAQ-SANFP-QFKPEEITGIMNDF-AV 56
            MSWQ+YVD ++ C++    L  A I G QDG VWA+   ++P Q   +E+  I +   + 
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCN 116
            P ++   G++LGG KY+ IQ +  +++RG+KG   + I  TN  L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MIVERLGDYL 126
             +VE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.