The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG
HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV
VERLGDYLVDQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
XP030492464 Can s 2.0101 133 904 232.8 2.3e-63
QVU02258 Que ac 2.0101 133 851 219.6 2.2e-59
O49894 Mer a 1 133 819 211.6 5.7e-57
P25816 Bet v 2 133 810 209.4 2.7e-56
A0A2I4DNN6 Jug r 7.0101 131 780 201.9 4.7e-54
Q9M7N0 Hev b 8.0201 131 780 201.9 4.7e-54
Q9LEI8 Hev b 8.0204 131 773 200.2 1.6e-53
AAL76933 Dau c 4 134 770 199.4 2.7e-53
Q9XF38 Pyr c 4 131 769 199.2 3.2e-53
Q9XF37 Api g 4 134 769 199.1 3.3e-53
O24170 Ole e 2 134 768 198.9 3.9e-53
O24169 Ole e 2 134 767 198.6 4.6e-53
Q8L5D8 Pho d 2.0101 131 763 197.7 9e-53
O24171 Ole e 2 134 763 197.6 9.2e-53
Q9XF40 Mal d 4 131 761 197.2 1.3e-52
Q9M7M8 Hev b 8.0203 131 760 196.9 1.5e-52
AAL07320 Lit c 1 131 757 196.2 2.5e-52
Q9M7M9 Hev b 8.0202 131 750 194.4 8.5e-52
Q9FUD1 Ory s 12.0101 131 743 192.7 2.9e-51
O24650 Phl p 12.0102 131 741 192.2 4e-51
FM164277 Tri a 12.0104 131 737 191.2 8.1e-51
P35083 Zea m 12.0103 131 735 190.7 1.1e-50
CAA54686 Phl p 12.0101 131 734 190.4 1.4e-50
P35079 Phl p 12.0101 131 734 190.4 1.4e-50
A0A023W2L7 Pro j 2.0101 133 733 190.2 1.6e-50
AAL92870 Che a 2 131 732 189.9 1.9e-50
P49232 Tri a 12.0101 138 732 189.9 2e-50
P49233 Tri a 12.0102 141 732 189.9 2.1e-50
P35081 Zea m 12.0101 131 730 189.4 2.7e-50
A0A0A0REA1 Koc s 2.0101 133 730 189.4 2.8e-50
QRN65366 Lig v 2.0101 134 730 189.4 2.8e-50
Q9AXH4 Cor a 2 131 727 188.7 4.5e-50
O22655 Zea m 12.0104 131 726 188.4 5.4e-50
QID21357 Pop n 2.0101 131 726 188.4 5.4e-50
AF377948 Mus a 1.0101 131 726 188.4 5.4e-50
ACP43298 Ama r 2.0101 133 726 188.4 5.5e-50
P35082 Zea m 12.0102 131 724 187.9 7.6e-50
O24282 Phl p 12.0103 131 724 187.9 7.6e-50
AAL29690 Lyc e 1 131 723 187.7 9.1e-50
P52184 Hor v 12.0101 131 721 187.2 1.3e-49
AAK01235 Cor a 2 131 721 187.2 1.3e-49
ACS34771 Sal k 4.0101 133 721 187.2 1.3e-49
Q9STB6 Hev b 8.0102 131 720 186.9 1.5e-49
A0A0A0RCW1 Aca f 2 133 720 186.9 1.6e-49
P49234 Tri a 12.0103 140 720 186.9 1.7e-49
O65812 Hev b 8.0101 131 718 186.4 2.2e-49
CAD37202 Pru p 4.0201 131 718 186.4 2.2e-49
Q9FR39 Zea m 12.0105 131 718 186.4 2.2e-49
AAP13533 Cuc m 2 131 717 186.2 2.6e-49
O04725 Cyn d 12 131 716 185.9 3e-49
AJ421030 Art v 4.0101 133 715 185.7 3.7e-49
ABU95412 Sin a 4.0101 131 713 185.2 5.1e-49
Q9XF42 Mal d 4 131 712 184.9 6.1e-49
O65809 Gly m 3 131 711 184.7 7.2e-49
O81982 Hel a 2 133 710 184.4 8.8e-49
Q9XF41 Mal d 4 131 709 184.2 1e-48
ADK22841 Sal k 4.0201 133 706 183.4 1.8e-48
Q5EF31 Cro s 1.0101 131 705 183.2 2e-48
O65810 Gly m 3 131 704 182.9 2.4e-48
AAK54835 Ana c 1 131 700 181.9 4.9e-48
CAD37201 Pru p 4.0101 131 700 181.9 4.9e-48
Q5XWE1 Citr l 2.0101 131 700 181.9 4.9e-48
AY081852 Pru du 4.0102 131 699 181.7 5.8e-48
AY081850 Pru du 4.0101 131 699 181.7 5.8e-48
CAD10376 Cap a 2 131 693 180.2 1.6e-47
Q9XF39 Pru av 4 131 693 180.2 1.6e-47
Q42449 Ara t 8 131 692 179.9 1.9e-47
Q9XG85 Par j 3 132 691 179.7 2.3e-47
P84177 Cit s 2.0101 131 690 179.4 2.7e-47
Q93YG7 Sola l 1.0101 131 687 178.7 4.6e-47
CAD10377 Lyc e 1 131 687 178.7 4.6e-47
AJ421031 Art v 4.0201 133 687 178.7 4.7e-47
Q9SQI9 Ara h 5 131 686 178.4 5.5e-47
Q9T0M8 Par j 3 131 678 176.4 2.2e-46
FG438715 Act d 9.0101 109 568 149.1 3.2e-38
QEQ43417 Sola m 1.0101 159 519 136.7 2.5e-34
A0A1B2YLJ4 Tyr p 36.0101 131 265 73.4 2.3e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 232.8 bits 904,  Expect = 2e-63
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLVDQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 2. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 219.6 bits 851,  Expect = 2e-59
 Identities = 122/133 91%, Positives = 128/133 96%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMCDIDGQGQHL AAAIIGHDGS+WAQSS+FPQ+KA+EI+DI KDFEEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGLHL GTKYMVIQGE GAVIRGKKGSGGVTIKKT QAL+FGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLVDQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 3. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 211.6 bits 819,  Expect = 6e-57
 Identities = 114/133 85%, Positives = 128/133 96%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDIDGQGQHL AA+I+GHDGSIWAQS+SFPQLK +EIT I KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL+++GTKYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 4. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 209.4 bits 810,  Expect = 3e-56
 Identities = 115/133 86%, Positives = 123/133 92%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMCDIDGQ  +  A+AI+GHDGS+WAQSSSFPQ+K QEIT I KDFEEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGLHL G KYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 5. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 201.9 bits 780,  Expect = 5e-54
 Identities = 112/131 85%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+IDGQ  HLTAAAIIGHDGS+WAQSSSFPQ+K +EI  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIDGQ--HLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE GAVIRGKKG+GG+T+KKTGQALIFGIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 201.9 bits 780,  Expect = 5e-54
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMCDIDG+  HLTAAAIIGHDGS+WAQSSSFPQ+K +E+  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGH--HLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPGAVIRGKKGSGG+T+KKTGQALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 200.2 bits 773,  Expect = 2e-53
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDIDG+   LTAAAIIGHDGS+WAQSSSFPQ+K+ E+  + KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPGAVIRGKKGSGG+T+KKTGQALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLLDQGL 131

Sequence Alignment: 8. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 199.4 bits 770,  Expect = 3e-53
 Identities = 107/133 80%, Positives = 127/133 95%, Gaps = 1/133 0%
Query  1    MSWQTYVDEHLMCDIDGQ-GQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
            MSWQTYVD+HLMC++DG  GQ+L+AAAIIGHDGS+WAQSS+FP++K +EIT I K+F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
            GHLAPTGL+L GTKYMVIQGEP AVIRGKKGSGGVTIKKTGQAL+FG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  VVERLGDYLVDQGL 133
            +VERLGDYL++QGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 9. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 199.2 bits 769,  Expect = 3e-53
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG+  HLTAAAI+GHDGS+WAQSS+FP++K +EIT I KDF+EPG
Sbjct  1    MSWQAYVDDHLMCDIDGH--HLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE GAVIRGKKGSGGVT+KKT QAL+FGIYEEP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 10. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 199.1 bits 769,  Expect = 3e-53
 Identities = 107/133 80%, Positives = 123/133 92%, Gaps = 1/133 0%
Query  1    MSWQTYVDEHLMCDIDGQ-GQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
            MSWQ YVD+HLMC+++G  GQ LTAAAIIGHDGS+WAQSS+FPQ+K +EI  I KDF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
            GHLAPTGL+L G KYMVIQGEP AVIRGKKGSGGVTIKKTGQAL+FG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  VVERLGDYLVDQGL 133
            +VERLGDYL+DQGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 11. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 198.9 bits 768,  Expect = 4e-53
 Identities = 108/133 81%, Positives = 123/133 92%, Gaps = 1/133 0%
Query  1    MSWQTYVDEHLMCDIDG-QGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
            MSWQ YVD+HLMCDI+G +G+ LTAAAI+GHDGS+WAQS++FPQ+K +E+  I  DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
            GHLAPTGLHL GTKYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLVDQGL 133
            VVERLGDYL++QGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 12. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 198.6 bits 767,  Expect = 5e-53
 Identities = 108/133 81%, Positives = 122/133 91%, Gaps = 1/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQH-LTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
            MSWQ YVD+HLMCDI+G+  H LTAAAI+GHDGS+WAQS++FPQ+K +E+  I  DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
            GHLAPTGLHL GTKYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLVDQGL 133
            VVERLGDYLV+QG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 13. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 197.7 bits 763,  Expect = 9e-53
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVDEHLMC+IDG+  HLTAAAI+GHDGS+WAQSSSFPQ+K++EIT+I  DF EPG
Sbjct  1    MSWQAYVDEHLMCEIDGH--HLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L  TKYMVIQGEPGAVIRGKKGSGGVT+KKT QALIFGIYEEP+TPGQCNMV
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIEQGM 131

Sequence Alignment: 14. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 197.6 bits 763,  Expect = 9e-53
 Identities = 107/133 80%, Positives = 122/133 91%, Gaps = 1/133 0%
Query  1    MSWQTYVDEHLMCDIDG-QGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
            MSWQ YVD+HLMCDI+G +G+ LTAAAI+GHDGS+WAQS++FPQ+K +E+  I  DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
            GHLAPTGLHL GTKYMVIQGE GAVIRGKKGSGG+TIKKTGQAL+FGIYEEPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLVDQGL 133
            V ERLGDYL++QGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 15. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 197.2 bits 761,  Expect = 1e-52
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+ LMCDIDG+  HLTAAAI+GHDGS+WA+SS+FP++K +EIT I KDF+EPG
Sbjct  1    MSWQAYVDDRLMCDIDGH--HLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE GAVIRGKKGSGGVT+KKTGQAL+FGIYEEP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 16. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 196.9 bits 760,  Expect = 2e-52
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDIDG+   LTAAAIIGHDGS+WAQSS FPQ+K+ E+  + KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPGAVIRGKKGSGG+T+KKTGQALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 17. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 196.2 bits 757,  Expect = 3e-52
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMC+ DGQ  HLTAAAIIGHDGS+WAQS++FPQ+K  EI  I KDF+EPG
Sbjct  1    MSWQTYVDDHLMCETDGQ--HLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPGAVIRGKKG GG+T+KKT QALI GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLVDQGL
Sbjct  119  VERLGDYLVDQGL 131

Sequence Alignment: 18. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 194.4 bits 750,  Expect = 8e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDIDG+   LTAAAIIGHDGS+WAQSSSFPQ+K+ E+  I KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL  TKYMVIQGEPGAVIRGKKGSGG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 19. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 192.7 bits 743,  Expect = 3e-51
 Identities = 104/131 79%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HLT+AAI+GHDG++WAQS++FPQ+K +E+T+I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L  TKYMVIQGEPGAVIRGKKGSGG+T+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 20. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 192.2 bits 741,  Expect = 4e-51
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HL +AAI+GHDG++WAQS+ FPQ+K +EIT I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTG+ ++G KYMVIQGEPGAVIRGKKG+GG+TIKKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 21. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 191.2 bits 737,  Expect = 8e-51
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSW+ YVD+HL C+IDGQ  HLT+AAI+GHDGS+WAQS +FPQ+K +EI  I KDFEEPG
Sbjct  1    MSWKAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG ALI+GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL+DQG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 190.7 bits 735,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HL++AAI+GHDG++WAQS++FPQ+K +E+T+I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAP GL L  TKYMVIQGEPGAVIRGKKGSGG+T+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 23. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 190.4 bits 734,  Expect = 1e-50
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HL +AAI+GHDG++WAQS+ FPQ+K +EIT I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTG+ ++G KYMVIQGEPG VIRGKKG+GG+TIKKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 24. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 190.4 bits 734,  Expect = 1e-50
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HL +AAI+GHDG++WAQS+ FPQ+K +EIT I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTG+ ++G KYMVIQGEPG VIRGKKG+GG+TIKKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 25. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 190.2 bits 733,  Expect = 2e-50
 Identities = 101/133 75%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMC+I+G   HL+AAAI+G DGS+WAQS+SFPQ+K  EI+ + KDF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPG VIRGKKG GG+ +KKTGQALI GIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 26. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 189.9 bits 732,  Expect = 2e-50
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDI+G   HL++AAI+GHDG++WAQS SFPQLK +E++ I KDF EPG
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPG VIRGKKG GGVTIKKT QALI GIY EP+TPGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VER+GDYLV+QG+
Sbjct  119  VERIGDYLVEQGM 131

Sequence Alignment: 27. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 189.9 bits 732,  Expect = 2e-50
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HL C+IDGQ  HLT+AAI+GHDGS+W +S +FP++K +EI  I KDFEEPG
Sbjct  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG ALI+GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL+DQG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 28. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 189.9 bits 732,  Expect = 2e-50
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HL C+IDGQ  HLT+AAI+GHDGS+WA+S +FP++K +EI  I KDFEEPG
Sbjct  1    MSWQAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG ALI+GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL+DQG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 189.4 bits 730,  Expect = 3e-50
 Identities = 101/131 77%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HLT+AAI+GHDG+ WAQS++FP++K +E+  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L GTKYMVIQGEPGAVIRGKKGSGG+T+KKTGQ+LI GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 30. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 189.4 bits 730,  Expect = 3e-50
 Identities = 102/133 76%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDI+G   HLT AAI+G DGS+WAQS++FPQ+K  EI  I K+F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE G VIRGKKG GG+ +KKTGQALIFGIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 31. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 189.4 bits 730,  Expect = 3e-50
 Identities = 105/133 78%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQH-LTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
            MSWQ YVD+HLMCDI+G+  H LTAAAI+GHDGS+WAQS++FPQ+K +EI  I  DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
            G LAPTGLHL GTKYMVIQGE GAVIRGKKGSGG+TIKKT QAL+FGIYEEPVTPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLVDQGL 133
            VV RLGD LV QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 32. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 188.7 bits 727,  Expect = 5e-50
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ Y DEHLMC+I+G    L AAAIIGHDGS+WAQSS+FPQLK +EIT +  DF EPG
Sbjct  1    MSWQAYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGAVIRGKKG GGVT+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 33. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 188.4 bits 726,  Expect = 5e-50
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVDEHLMC+I+GQ  HL+AAAI+GHDGS+WAQS SFP+LK +E+  I KDF+EPG
Sbjct  1    MSWQAYVDEHLMCEIEGQ--HLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL + GTKYMVIQGEPG VIRGKKG+GG+TIKKTG +LI G+Y+EP+TPGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIEQGF 131

Sequence Alignment: 34. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 188.4 bits 726,  Expect = 5e-50
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDI+G    LT+AAIIGHDGS+WA S+SFPQ+  +E++ I KDFEEPG
Sbjct  1    MSWQVYVDDHLMCDIEGN--TLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGEPGAVIRGKKGSGGVT+KKT QALI G+Y+EP+TPGQCNM+
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 188.4 bits 726,  Expect = 5e-50
 Identities = 106/131 80%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HL+CDIDGQ   LTAAAI+GHDGS+WAQS +FPQ K +EI  I KDF+EPG
Sbjct  1    MSWQAYVDDHLLCDIDGQ--CLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGAVIRGKKGSGGVTIKKT  ALI GIY EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL DQG+
Sbjct  119  VERLGDYLFDQGF 131

Sequence Alignment: 36. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 188.4 bits 726,  Expect = 6e-50
 Identities = 99/132 75%, Positives = 116/132 87%, Gaps = 0/132 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+I+G   HLT AAI+G DGS+WAQS+ FPQ+K  EI  I +DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPGAVIRGKKG+GG+ +KKTGQAL+ GIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQG 132
            VERLGDYL++QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 37. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 187.9 bits 724,  Expect = 8e-50
 Identities = 99/131 75%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVDEHLMC+I+G+  HL AAAI+GHDG+ WAQS++FP++K +++ +I KDF+EPG
Sbjct  1    MSWQAYVDEHLMCEIEGH--HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L  TKYMVIQGEPGAVIRGKKGSGG+T+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 38. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 187.9 bits 724,  Expect = 8e-50
 Identities = 100/131 76%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMC+I+G+  HL +AAI GHDG++WAQS+ FPQ+K +EIT I KD++EPG
Sbjct  1    MSWQTYVDEHLMCEIEGH--HLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTG+ ++  KYMVIQGEPGAVIRGKKG+GG+TIKKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 39. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 187.7 bits 723,  Expect = 9e-50
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDI+G   HLT+AAIIG+DGS+WAQS++FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE GAVIRGKKG+GG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDY+++QGL
Sbjct  119  VERLGDYIIEQGL 131

Sequence Alignment: 40. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 187.2 bits 721,  Expect = 1e-49
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HL C+IDGQ  HLT+AAI+GHDG +W QS +FPQ+K +EI  I KDF+EPG
Sbjct  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG  LI+GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  119  VERLGDYLVEQGF 131

Sequence Alignment: 41. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 187.2 bits 721,  Expect = 1e-49
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTY DEHLMC+I+G    L AAAIIGHDGS+WAQSS+FPQLK +EIT +  DF EPG
Sbjct  1    MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGAVIR KKG GGVT+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 42. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 187.2 bits 721,  Expect = 1e-49
 Identities = 100/133 75%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMC+I+G   HLTAAAI+G DGS+WAQS++FPQ+K  EI+ + K+F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE G VIRGKKG GG+ +KKTGQALIFGIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 43. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 186.9 bits 720,  Expect = 2e-49
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+I+G   HL+AAAIIG+DGS+WAQS++FPQ+K++EIT I  DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGEPGAVIRGKKG GGVT+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL+DQG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 186.9 bits 720,  Expect = 2e-49
 Identities = 98/133 73%, Positives = 115/133 86%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            M WQTYVD+HLMC+I+G   HL+ AAI+G DGS+WAQS+SFPQ+K  EI  + KDF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGEPG  IRGKKG GG+ +KKTGQAL+FGIY+EPVTPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 45. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 186.9 bits 720,  Expect = 2e-49
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSW+ YVD+HL C+IDGQ  +LT+AAI+GHDGS+WAQS +FPQ+K +E   I KDFEEPG
Sbjct  1    MSWKAYVDDHLCCEIDGQ--NLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG ALI+GIY+EP+TPGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL+DQG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 46. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 186.4 bits 718,  Expect = 2e-49
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDE LMC+I+G   HLTAAAIIG+DGS+WAQSS+FPQ+K++EIT I  DF+EPG
Sbjct  1    MSWQTYVDERLMCEIEGN--HLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGLHL GTKYMVIQGE GAVIRGKKG GGVT++KT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 47. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 186.4 bits 718,  Expect = 2e-49
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+I+G   HL+AAAIIGHDGS+WAQS++FPQLK +E+T I  DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGAVIRGKKG GGVT+KK+  AL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYLV+QGL
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 48. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 186.4 bits 718,  Expect = 2e-49
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HL+CDI+GQ  HL+AAAI+GHDGS+WAQS +FP+LK +E+  + KDF+EPG
Sbjct  1    MSWQAYVDDHLLCDIEGQ--HLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL + GTKYMVIQGEPG VIRGKKG+GG+TIKKTG +LI GIY+EP+TPGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIEQGF 131

Sequence Alignment: 49. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 186.2 bits 717,  Expect = 3e-49
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVDEHLMC+I+G   HLT+AAIIG+DGS+WAQS +FPQLK +E+  I  DF +PG
Sbjct  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL++ GTKYMVIQGEPGAVIRGKKG GGVT+KKTG AL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQGL
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 185.9 bits 716,  Expect = 3e-49
 Identities = 98/131 74%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+I+G+  HLT+AAIIGHDG++WAQS++FP +K +E+ +I KDF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGH--HLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L  TKYMVIQGEPGAVIRGKKGSGGVT+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            +E+LGDYL++QG+
Sbjct  119  IEKLGDYLIEQGM 131

Sequence Alignment: 51. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 185.7 bits 715,  Expect = 4e-49
 Identities = 99/133 74%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDI+G GQHLT+AAI G DG++WA+S+SFP++K  EI  I K+F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
            +LAPTGL L G KYMVIQGE GAVIRGKKG+GG+ IKKTGQA++FGIY+EPV PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+DQG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 52. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 185.2 bits 713,  Expect = 5e-49
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCD++G    LTAAAI+G+DGS+WAQS++FPQLK +EI  I  DF EPG
Sbjct  1    MSWQTYVDDHLMCDVEGN--RLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL + GTKYMVIQGEP AVIRGKKG+GGVTIKKT QA++FGIYEEP+TPGQCNMV
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 184.9 bits 712,  Expect = 6e-49
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS+SFP +K +EI  I KDF++PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGEPGAVIRGKKGSGG+TIKKT QAL+ GIY+EPVTPGQCN+V
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 54. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 184.7 bits 711,  Expect = 7e-49
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HL+CDI+G   HLT AAIIG+DGS+WAQS+ FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGAVIRGKKG GGVT+KKTG ALI GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQG 132
            VER GDYL+DQG
Sbjct  119  VERPGDYLIDQG 130

Sequence Alignment: 55. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 184.4 bits 710,  Expect = 9e-49
 Identities = 96/133 72%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVDEHLMCDI+G GQHLT+AAI+G DG++WAQS+ FPQ+K +E+  I K+F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTG+ ++G KYMV+QGEPGAVIRGKKG+GG+ IKKTGQA+I GIY+EPV PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 56. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 184.2 bits 709,  Expect = 1e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+I+G   HL+AAAIIGH+GS+WAQS++FPQLK +E+T I  DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPG VIRGKKG GGVT+KK+  AL+ GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 57. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 183.4 bits 706,  Expect = 2e-48
 Identities = 102/133 76%, Positives = 114/133 85%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVDEHLMC+I+  G HLT++AI+G DGSIWAQSS+FPQ+K QEI  I K+F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L G KYMVIQGEPGAVIRGKKG GGV IKKT QALIFGIY+EPV PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 58. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 183.2 bits 705,  Expect = 2e-48
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHLMCD+DG+   LT+AAI+GHDGS+WAQS+ FP+LK  EIT I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDMDGH--VLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTG++++G KYMVIQGEPG VIRGKKGSGGVTIKK+  ALIFG+Y+EP+TPGQCN+V
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 59. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 182.9 bits 704,  Expect = 2e-48
 Identities = 101/130 77%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HL+C I+G   HLT AAIIG+DGS+W QS+ FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGAVIRGKKG GGVT+KKTG ALI GIY+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQG 132
            VERLGDYL+DQG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 60. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 181.9 bits 700,  Expect = 5e-48
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+IDGQ  HL++AAI+GHD ++WAQS +FPQ+K +EI+ I  DFE PG
Sbjct  1    MSWQAYVDDHLMCEIDGQ--HLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI G+Y+EP+TPGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGF 131

Sequence Alignment: 61. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 181.9 bits 700,  Expect = 5e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS++FP +K +EI  I KDF++PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 62. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 181.9 bits 700,  Expect = 5e-48
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMC+I+G   HLT+AAIIG+DGS+WA+S +FPQLK +EIT I  DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL++ G+KYMVIQGEPGAVIRGKKG GGVT+KKT  AL+ GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 63. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 181.7 bits 699,  Expect = 6e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS++FP +K +EI  I KDF++PG
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 64. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 181.7 bits 699,  Expect = 6e-48
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS++FP +K +EI  I KDF++PG
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 65. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 180.2 bits 693,  Expect = 2e-47
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMC+I+G    LT+AAIIG+DGS+WAQS++FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGE GAVIRGKKG GG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++Q L
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 66. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 180.2 bits 693,  Expect = 2e-47
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS++FP +K +EI  I KD+++PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 67. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 179.9 bits 692,  Expect = 2e-47
 Identities = 100/131 76%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ+YVD+HLMCD++G   HLTAAAI+G+DGS+WAQS+ FPQLK QEI  I KDFEEPG
Sbjct  1    MSWQSYVDDHLMCDVEGN--HLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L G KYMVIQGE GAVIRGKKG GGVTIKKT QAL+FG Y+EP+T GQCN+V
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++  L
Sbjct  119  VERLGDYLIESEL 131

Sequence Alignment: 68. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 179.7 bits 691,  Expect = 2e-47
 Identities = 98/132 74%, Positives = 114/132 86%, Gaps = 1/132 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCD+ G G    +AAIIGHDGS+WAQS++FPQLK +E+T I  DF E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG T+KKTGQA++ GIY+EP+TPGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  120  VERLGDYLLEQGL 132

Sequence Alignment: 69. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 179.4 bits 690,  Expect = 3e-47
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCDIDG    LTAAAI+G+DGS+W+QS++FP ++ +EI  I KDF++PG
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG+ +KKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QGL
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 70. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 178.7 bits 687,  Expect = 5e-47
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHL+C+   +G HLT+AAIIG+DG++WAQS++FPQ+K +EIT I  DF  PG
Sbjct  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEP AVIRGKKG GG+TIKKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++Q L
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 71. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 178.7 bits 687,  Expect = 5e-47
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVDEHL+C+   +G HLT+AAIIG+DG++WAQS++FPQ+K +EIT I  DF  PG
Sbjct  1    MSWQTYVDEHLLCE--NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEP AVIRGKKG GG+TIKKT QALI GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++Q L
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 72. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 178.7 bits 687,  Expect = 5e-47
 Identities = 94/133 70%, Positives = 113/133 84%, Gaps = 0/133 0%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMCDI+G GQHLTAAAI+G DG++WA+S  FP++K +E+  I  +F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L G KYMV+QGE GAVIRGKKG+GG+ IKKTGQA++ GIY+EPV PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLVDQGL 133
            VERLGDYLVDQ +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 73. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 178.4 bits 686,  Expect = 5e-47
 Identities = 97/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD HL+C+I+G   HL++AAI+G+DG +WAQSS FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDNHLLCEIEGD--HLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL+L GTKYMVIQGEPGA+I GKKG GGVTI+KT QALI GIY++P+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL+D GL
Sbjct  119  VERLGDYLIDTGL 131

Sequence Alignment: 74. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 176.4 bits 678,  Expect = 2e-46
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQ YVD+HLMCD+ G G  L +AAIIGHDGS+WAQS++FPQLK +E+T I  DF E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
             LAPTGL L GTKYMVIQGE GAVI GKKGSGG T+KKTGQA++ GIY+EP+TPGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVDQGL 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 149.1 bits 568,  Expect = 3e-38
 Identities = 85/109 77%, Positives = 97/109 88%, Gaps = 2/109 1%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
            MSWQTYVD+HLMC+I+G   +LT+AAIIG+DGSIWAQS+SFPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEP 111
             LAPTGL+L GTKYMVIQGE GAVIRGKKG GGVT+KKT QALI GIY+EP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 136.7 bits 519,  Expect = 2e-34
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 30/130 23%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQ----------------- 43
            MSWQTYVD+HLMCD++G+  HL +AAI+G DGS+WAQS +FP+                 
Sbjct  1    MSWQTYVDDHLMCDLEGH--HLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------LKAQEITDITKDFEEPGHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSG 92
                       +K +EIT+I KDF+EPG LAPTGL L GTKYMVIQGEPGAVIRGKKGS 
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GVTIKKTGQALIFGIYEEPVTPGQCNMVVERLGDYLVDQG 132
            G+TIKKTGQALIFGIYEEPVTPGQCNMVVE++GDYLVDQG
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 73.4 bits 265,  Expect = 2e-15
 Identities = 49/122 40%, Positives = 73/122 59%, Gaps = 10/122 8%
Query  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIG-HDGSIWAQ-SSSFP-QLKAQEITDITKDFE 57
            MSWQ+YVD ++   +D +      A I G +DG++WA+    +P Q+  QE+  I     
Sbjct  1    MSWQSYVDNQICQHVDCR-----LAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  58   -EPGHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQ 116
              P  +   G+HL G KY+ IQ +  +++RG+KGS  + I  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  117  CNMVVERLGDYL 128
             N VVE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.