The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL
APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE
RLGDYLIEQGY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q5EF31 Cro s 1.0101 131 892 251.7 4.7e-69
Q8L5D8 Pho d 2.0101 131 756 214.3 8.6e-58
Q9XF41 Mal d 4 131 747 211.8 4.8e-57
Q9M7N0 Hev b 8.0201 131 747 211.8 4.8e-57
O24650 Phl p 12.0102 131 746 211.6 5.8e-57
CAD37202 Pru p 4.0201 131 744 211.0 8.5e-57
AAK54835 Ana c 1 131 744 211.0 8.5e-57
CAA54686 Phl p 12.0101 131 743 210.7 1e-56
P35079 Phl p 12.0101 131 743 210.7 1e-56
Q9M7M8 Hev b 8.0203 131 739 209.6 2.2e-56
AF377948 Mus a 1.0101 131 737 209.1 3.2e-56
O22655 Zea m 12.0104 131 735 208.5 4.7e-56
Q5XWE1 Citr l 2.0101 131 734 208.3 5.7e-56
Q9XF38 Pyr c 4 131 734 208.3 5.7e-56
AAL07320 Lit c 1 131 733 208.0 6.9e-56
AAL92870 Che a 2 131 732 207.7 8.4e-56
Q9FR39 Zea m 12.0105 131 731 207.4 1e-55
AAL29690 Lyc e 1 131 730 207.2 1.2e-55
A0A2I4DNN6 Jug r 7.0101 131 728 206.6 1.8e-55
O65809 Gly m 3 131 727 206.3 2.2e-55
Q9AXH4 Cor a 2 131 727 206.3 2.2e-55
O24282 Phl p 12.0103 131 727 206.3 2.2e-55
Q9LEI8 Hev b 8.0204 131 727 206.3 2.2e-55
FM164277 Tri a 12.0104 131 727 206.3 2.2e-55
P49232 Tri a 12.0101 138 726 206.0 2.8e-55
P49233 Tri a 12.0102 141 726 206.0 2.9e-55
Q9M7M9 Hev b 8.0202 131 725 205.8 3.2e-55
Q9FUD1 Ory s 12.0101 131 725 205.8 3.2e-55
P35081 Zea m 12.0101 131 724 205.5 3.8e-55
P52184 Hor v 12.0101 131 722 205.0 5.6e-55
CAD10376 Cap a 2 131 722 205.0 5.6e-55
AAK01235 Cor a 2 131 721 204.7 6.8e-55
O65810 Gly m 3 131 720 204.4 8.2e-55
P49234 Tri a 12.0103 140 720 204.4 9.1e-55
ABU95412 Sin a 4.0101 131 719 204.1 1e-54
Q9XF42 Mal d 4 131 719 204.1 1e-54
Q9STB6 Hev b 8.0102 131 718 203.9 1.2e-54
Q9XF40 Mal d 4 131 717 203.6 1.5e-54
CAD37201 Pru p 4.0101 131 716 203.3 1.8e-54
QID21357 Pop n 2.0101 131 716 203.3 1.8e-54
AY081852 Pru du 4.0102 131 715 203.0 2.1e-54
AY081850 Pru du 4.0101 131 715 203.0 2.1e-54
AAP13533 Cuc m 2 131 714 202.8 2.6e-54
O49894 Mer a 1 133 713 202.5 3.2e-54
P35083 Zea m 12.0103 131 710 201.7 5.5e-54
Q9XF39 Pru av 4 131 709 201.4 6.7e-54
O04725 Cyn d 12 131 707 200.8 9.8e-54
XP030492464 Can s 2.0101 133 705 200.3 1.5e-53
Q93YG7 Sola l 1.0101 131 703 199.7 2.1e-53
CAD10377 Lyc e 1 131 703 199.7 2.1e-53
O24169 Ole e 2 134 702 199.4 2.6e-53
O24170 Ole e 2 134 700 198.9 3.8e-53
AAL76933 Dau c 4 134 700 198.9 3.8e-53
Q9XG85 Par j 3 132 699 198.6 4.6e-53
Q9XF37 Api g 4 134 699 198.6 4.7e-53
Q9SQI9 Ara h 5 131 695 197.5 9.7e-53
P25816 Bet v 2 133 695 197.5 9.9e-53
O24171 Ole e 2 134 695 197.5 1e-52
P84177 Cit s 2.0101 131 693 197.0 1.4e-52
QRN65366 Lig v 2.0101 134 693 197.0 1.5e-52
O65812 Hev b 8.0101 131 692 196.7 1.7e-52
ACP43298 Ama r 2.0101 133 689 195.9 3.1e-52
Q9T0M8 Par j 3 131 688 195.6 3.7e-52
QVU02258 Que ac 2.0101 133 686 195.0 5.5e-52
Q42449 Ara t 8 131 685 194.8 6.5e-52
P35082 Zea m 12.0102 131 684 194.5 7.9e-52
A0A0A0REA1 Koc s 2.0101 133 678 192.8 2.5e-51
O81982 Hel a 2 133 670 190.6 1.2e-50
A0A023W2L7 Pro j 2.0101 133 670 190.6 1.2e-50
AJ421030 Art v 4.0101 133 669 190.4 1.4e-50
ACS34771 Sal k 4.0101 133 662 188.4 5.3e-50
A0A0A0RCW1 Aca f 2 133 662 188.4 5.3e-50
ADK22841 Sal k 4.0201 133 654 186.2 2.4e-49
AJ421031 Art v 4.0201 133 640 182.4 3.5e-48
FG438715 Act d 9.0101 109 594 169.9 1.7e-44
QEQ43417 Sola m 1.0101 159 485 139.7 3.1e-35
A0A1B2YLJ4 Tyr p 36.0101 131 254 76.2 3.1e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 251.7 bits 892,  Expect = 5e-69
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLIEQGY
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 2. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 214.3 bits 756,  Expect = 9e-58
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVDEHLMC++DGH LT+AAILGHDGSVWAQS+ FP++K  EIT I+NDFNEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+   KYMVIQGEPG VIRGKKGSGGVT+KK+N ALIFG+Y+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 3. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 211.8 bits 747,  Expect = 5e-57
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMC+++G+ L++AAI+GH+GSVWAQSA FP+LKP E+T I+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPGVVIRGKKG GGVT+KKS MAL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 4. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 211.8 bits 747,  Expect = 5e-57
 Identities = 99/130 76%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMCD+DGH LT+AAI+GHDGSVWAQS+ FP++KP E+ AI+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKGSGG+T+KK+  ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 5. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 211.6 bits 746,  Expect = 6e-57
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH L SAAILGHDG+VWAQSA FP++KP EIT I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTGM++ GAKYMVIQGEPG VIRGKKG+GG+TIKK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 6. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 211.0 bits 744,  Expect = 8e-57
 Identities = 100/130 76%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMC+++G+ L++AAI+GHDGSVWAQSA FP+LKP E+T ILNDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKG GGVT+KKS +AL+ G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 7. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 211.0 bits 744,  Expect = 8e-57
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMC++DG+ L+SAAILGHD +VWAQS  FP++KP EI+AILNDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPGVVIRGKKG+GG+T+KK+N+ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 8. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 210.7 bits 743,  Expect = 1e-56
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH L SAAILGHDG+VWAQSA FP++KP EIT I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTGM++ GAKYMVIQGEPG VIRGKKG+GG+TIKK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 9. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 210.7 bits 743,  Expect = 1e-56
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH L SAAILGHDG+VWAQSA FP++KP EIT I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTGM++ GAKYMVIQGEPG VIRGKKG+GG+TIKK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 10. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 209.6 bits 739,  Expect = 2e-56
 Identities = 97/130 74%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMCD+DGH LT+AAI+GHDGSVWAQS+GFP++K  E+ A++ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKGSGG+T+KK+  ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 11. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 209.1 bits 737,  Expect = 3e-56
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HL+CD+DG+ LT+AAI+GHDGSVWAQS  FP+ KP EI AI+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKGSGGVTIKK+N+ALI G+Y+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYL +QG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 12. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 208.5 bits 735,  Expect = 5e-56
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVDEHLMC+++G+ L++AAI+GHDGSVWAQS  FPELKP E+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ M+LI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 13. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 208.3 bits 734,  Expect = 6e-56
 Identities = 100/130 76%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMC+++G+ LTSAAI+G+DGSVWA+S  FP+LKP EIT ILNDFNEPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+YI G+KYMVIQGEPG VIRGKKG GGVT+KK+ +AL+ G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 14. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 208.3 bits 734,  Expect = 6e-56
 Identities = 99/130 76%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DGH LT+AAILGHDGSVWAQS+ FP++KP EITAI+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGGVT+KK++ AL+FG+Y+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 15. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 208.0 bits 733,  Expect = 7e-56
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMC+ DG+ LT+AAI+GHDGSVWAQSA FP++KPAEI AI+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KK+  ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVDQG 130

Sequence Alignment: 16. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 207.7 bits 732,  Expect = 8e-56
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMCD++G+ L+SAAILGHDG+VWAQS  FP+LKP E++AI+ DFNEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GGVTIKK+N ALI G+Y EPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            R+GDYL+EQG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 17. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 207.4 bits 731,  Expect = 1e-55
 Identities = 96/131 73%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HL+CD++G+ L++AAI+GHDGSVWAQS  FPELKP E+  ++ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ M+LI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 18. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 207.2 bits 730,  Expect = 1e-55
 Identities = 99/130 76%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMCD++G+ LTSAAI+G+DGSVWAQSA FP++KP EITAI+NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKG+GG+T+KK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDY+IEQG
Sbjct  121  RLGDYIIEQG 130

Sequence Alignment: 19. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 206.6 bits 728,  Expect = 2e-55
 Identities = 97/130 74%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC++DG+ LT+AAI+GHDGSVWAQS+ FP++KP EI AI+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKG+GG+T+KK+  ALIFG+YDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 20. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 206.3 bits 727,  Expect = 2e-55
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HL+CD++G+ LT AAI+G+DGSVWAQS  FP++KP EITAI+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKG GGVT+KK+  ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGY 131
            R GDYLI+QGY
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 21. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 206.3 bits 727,  Expect = 2e-55
 Identities = 98/130 75%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ Y DEHLMC+++G+ L +AAI+GHDGSVWAQS+ FP+LKP EIT ++NDFNEPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKG GGVT+KK++ ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 206.3 bits 727,  Expect = 2e-55
 Identities = 98/130 75%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH L SAAI+GHDG+VWAQSA FP++KP EIT I+ D++EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTGM++  AKYMVIQGEPG VIRGKKG+GG+TIKK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 23. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 206.3 bits 727,  Expect = 2e-55
 Identities = 95/130 73%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMCD+DGH LT+AAI+GHDGSVWAQS+ FP++K  E+ A++ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKGSGG+T+KK+  ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLDQG 130

Sequence Alignment: 24. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 206.3 bits 727,  Expect = 2e-55
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSW+ YVD+HL C++DG+ LTSAAILGHDGSVWAQS  FP++KP EI  I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ MALI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 25. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 206.0 bits 726,  Expect = 3e-55
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HL C++DG+ LTSAAILGHDGSVW +S  FP++KP EI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ MALI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 26. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 206.0 bits 726,  Expect = 3e-55
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HL C++DG+ LTSAAILGHDGSVWA+S  FP++KP EI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ MALI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 27. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 205.8 bits 725,  Expect = 3e-55
 Identities = 96/130 73%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMCD+DGH LT+AAI+GHDGSVWAQS+ FP++K  E+ AI+ DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGG+T+KK++ ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 28. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 205.8 bits 725,  Expect = 3e-55
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH LTSAAI+GHDG+VWAQSA FP++KP E+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGG+T+KK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 29. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 205.5 bits 724,  Expect = 4e-55
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH LTSAAI+GHDG+ WAQS  FPE+KP E+ AI+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKGSGG+T+KK+  +LI G+YDEPMTPGQCNLVVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 30. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 205.0 bits 722,  Expect = 6e-55
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HL C++DG+ LTSAAILGHDG VW QS  FP++KP EI  I+ DF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ M LI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 31. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 205.0 bits 722,  Expect = 6e-55
 Identities = 99/129 76%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMC+++G+ LTSAAI+G+DGSVWAQSA FP++KP EITAI+NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGE G VIRGKKG GG+T+KK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLIEQ
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 32. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 204.7 bits 721,  Expect = 7e-55
 Identities = 98/130 75%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTY DEHLMC+++G+ L +AAI+GHDGSVWAQS+ FP+LKP EIT ++NDFNEPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG VIR KKG GGVT+KK++ ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 204.4 bits 720,  Expect = 8e-55
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HL+C ++G+ LT AAI+G+DGSVW QS  FP++KP EITAI+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKG GGVT+KK+  ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 34. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 204.4 bits 720,  Expect = 9e-55
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSW+ YVD+HL C++DG+ LTSAAILGHDGSVWAQS  FP++KP E   I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ MALI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 35. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 204.1 bits 719,  Expect = 1e-54
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMCD++G+ LT+AAILG+DGSVWAQSA FP+LKP EI  I NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG++I G KYMVIQGEP  VIRGKKG+GGVTIKK+  A++FG+Y+EPMTPGQCN+VVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 36. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 204.1 bits 719,  Expect = 1e-54
 Identities = 98/130 75%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP +KP EI AIL DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKGSGG+TIKK++ AL+ G+YDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 37. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 203.9 bits 718,  Expect = 1e-54
 Identities = 97/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMC+++G+ L++AAI+G+DGSVWAQSA FP++K  EIT I++DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+YI G KYMVIQGEPG VIRGKKG GGVT+KK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 38. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 203.6 bits 717,  Expect = 1e-54
 Identities = 97/130 74%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+ LMCD+DGH LT+AAILGHDGSVWA+S+ FP++KP EITAI+ DF+EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGGVT+KK+  AL+FG+Y+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 203.3 bits 716,  Expect = 2e-54
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP +KP EI AIL DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGG+T+KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 40. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 203.3 bits 716,  Expect = 2e-54
 Identities = 96/130 73%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD++G+ LTSAAI+GHDGSVWA SA FP++   E++AI+ DF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKGSGGVT+KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 41. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 203.0 bits 715,  Expect = 2e-54
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP +KP EI AIL DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGG+T+KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 42. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 203.0 bits 715,  Expect = 2e-54
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP +KP EI AIL DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGG+T+KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 43. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 202.8 bits 714,  Expect = 3e-54
 Identities = 96/130 73%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVDEHLMC+++G+ LTSAAI+G+DGSVWAQS  FP+LKP E+  I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+YI G KYMVIQGEPG VIRGKKG GGVT+KK+ MAL+ G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 202.5 bits 713,  Expect = 3e-54
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVD+HLMCD+DG+   L +A+I+GHDGS+WAQSA FP+LKP EIT I+ DF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
             LAPTG+YI G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 45. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 201.7 bits 710,  Expect = 6e-54
 Identities = 94/130 72%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHLMC+++GH L+SAAI+GHDG+VWAQS  FP++KP E+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            AP G+++   KYMVIQGEPG VIRGKKGSGG+T+KK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 46. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 201.4 bits 709,  Expect = 7e-54
 Identities = 96/130 73%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP +KP EI AIL D+++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGG+T+KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 47. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 200.8 bits 707,  Expect = 1e-53
 Identities = 94/130 72%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMC+++GH LTSAAI+GHDG+VWAQSA FP +KP E+  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGGVT+KK+  AL+ G+YDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQG 130
            +LGDYLIEQG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 48. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 200.3 bits 705,  Expect = 1e-53
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVDEHLMCD+DG+   LT+AAI+GHDGS+WAQS+ FP+LK  EIT I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
             LAPTG++++G KYMVIQGEPG VIRGKKGSGGVTIKK+  ALIFG+Y+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 49. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 199.7 bits 703,  Expect = 2e-53
 Identities = 97/129 75%, Positives = 115/129 89%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHL+C+ +G+ LTSAAI+G+DG+VWAQSA FP++KP EIT I+NDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEP  VIRGKKG GG+TIKK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLIEQ
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 50. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 199.7 bits 703,  Expect = 2e-53
 Identities = 97/129 75%, Positives = 115/129 89%, Gaps = 0/129 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDEHL+C+ +G+ LTSAAI+G+DG+VWAQSA FP++KP EIT I+NDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEP  VIRGKKG GG+TIKK+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQ 129
            RLGDYLIEQ
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 51. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 199.4 bits 702,  Expect = 3e-53
 Identities = 96/130 73%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQTYVDEHLMCDMDGHV---LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
            MSWQ YVD+HLMCD++GH    LT+AAI+GHDGSVWAQSA FP++KP E+  I+ DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
            G LAPTG+++ G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQG 130
            VVERLGDYL+EQG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 52. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 198.9 bits 700,  Expect = 4e-53
 Identities = 96/130 73%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQTYVDEHLMCDMDGHV---LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
            MSWQ YVD+HLMCD++GH    LT+AAI+GHDGSVWAQSA FP++KP E+  I+ DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
            G LAPTG+++ G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQG 130
            VVERLGDYL+EQG
Sbjct  121  VVERLGDYLLEQG 133

Sequence Alignment: 53. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 198.9 bits 700,  Expect = 4e-53
 Identities = 98/130 75%, Positives = 118/130 90%, Gaps = 3/130 2%
Query  1    MSWQTYVDEHLMCDMDGHV---LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
            MSWQTYVD+HLMC++DG+    L++AAI+GHDGSVWAQS+ FP++KP EIT I+ +F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
            G LAPTG+Y+ G KYMVIQGEP  VIRGKKGSGGVTIKK+  AL+FG+YDEP+TPGQCNL
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIEQG 130
            +VERLGDYLIEQG
Sbjct  121  IVERLGDYLIEQG 133

Sequence Alignment: 54. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 198.6 bits 699,  Expect = 5e-53
 Identities = 97/130 74%, Positives = 113/130 86%, Gaps = 1/130 0%
Query  1    MSWQTYVDEHLMCDM-DGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGS 59
            MSWQ YVD+HLMCD+ DG+   SAAI+GHDGSVWAQSA FP+LKP E+T I+NDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVV 119
            LAPTG+++ G KYMVIQGE G VIRGKKGSGG T+KK+  A++ G+YDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQG 130
            ERLGDYL+EQG
Sbjct  121  ERLGDYLLEQG 131

Sequence Alignment: 55. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 198.6 bits 699,  Expect = 5e-53
 Identities = 96/130 73%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQTYVDEHLMCDMDGH---VLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
            MSWQ YVD+HLMC+++G+    LT+AAI+GHDGSVWAQS+ FP++KP EI  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
            G LAPTG+Y+ GAKYMVIQGEP  VIRGKKGSGGVTIKK+  AL+FG+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIEQG 130
            +VERLGDYLI+QG
Sbjct  121  IVERLGDYLIDQG 133

Sequence Alignment: 56. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 197.5 bits 695,  Expect = 1e-52
 Identities = 95/130 73%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD HL+C+++G  L+SAAILG+DG VWAQS+ FP++KP EITAI+NDF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+Y+ G KYMVIQGEPG +I GKKG GGVTI+K+N ALI G+YD+PMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+ G
Sbjct  121  RLGDYLIDTG 130

Sequence Alignment: 57. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 197.5 bits 695,  Expect = 1e-52
 Identities = 96/130 73%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDGHVLTS--AAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVDEHLMCD+DG+   S  +AI+GHDGSVWAQS+ FP++KP EIT I+ DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
             LAPTG+++ G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIDQG 132

Sequence Alignment: 58. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 197.5 bits 695,  Expect = 1e-52
 Identities = 95/130 73%, Positives = 115/130 88%, Gaps = 3/130 2%
Query  1    MSWQTYVDEHLMCDMDGHV---LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
            MSWQ YVD+HLMCD++GH    LT+AAI+GHDGSVWAQSA FP++KP E+  I+ DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
            G LAPTG+++ G KYMVIQGE G VIRGKKGSGG+TIKK+  AL+FG+Y+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQG 130
            V ERLGDYL+EQG
Sbjct  121  VAERLGDYLLEQG 133

Sequence Alignment: 59. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 197.0 bits 693,  Expect = 1e-52
 Identities = 94/130 72%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVD+HLMCD+DG+ LT+AAILG+DGSVW+QSA FP ++  EI AIL DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKGSGG+ +KK+N ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 60. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 197.0 bits 693,  Expect = 1e-52
 Identities = 95/130 73%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQTYVDEHLMCDMDGHV---LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
            MSWQ YVD+HLMCD++GH    LT+AAI+GHDGSVWAQSA FP++KP EI  I+ DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
            G+LAPTG+++ G KYMVIQGE G VIRGKKGSGG+TIKK+N AL+FG+Y+EP+TPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQG 130
            VV RLGD L++QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 61. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 196.7 bits 692,  Expect = 2e-52
 Identities = 94/130 72%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVDE LMC+++G+ LT+AAI+G+DGSVWAQS+ FP++K  EITAI++DF+EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKG GGVT++K+N ALI G+YDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 62. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 195.9 bits 689,  Expect = 3e-52
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQ YVD+HLMC+++G    LT AAILG DGSVWAQSA FP++KP EI AI+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ G KYMVIQGEPG VIRGKKG+GG+ +KK+  AL+ G+YDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGY 131
            VERLGDYLIEQGY
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 63. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 195.6 bits 688,  Expect = 4e-52
 Identities = 97/129 75%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQTYVDEHLMCDM-DGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGS 59
            MSWQ YVD+HLMCD+ DG+ L SAAI+GHDGSVWAQSA FP+LKP E+T I+NDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVV 119
            LAPTG+++ G KYMVIQGE G VI GKKGSGG T+KK+  A++ G+YDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 64. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 195.0 bits 686,  Expect = 5e-52
 Identities = 95/130 73%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVDEHLMCD+DG+   L +AAI+GHDGSVWAQS+ FP++K  EI+ I+ DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
             LAPTG+++ G KYMVIQGE G VIRGKKGSGGVTIKK++ AL+FG+Y+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 65. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 194.8 bits 685,  Expect = 7e-52
 Identities = 98/128 76%, Positives = 112/128 87%, Gaps = 0/128 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ+YVD+HLMCD++G+ LT+AAILG+DGSVWAQSA FP+LKP EI  I  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGE G VIRGKKG GGVTIKK+N AL+FG+YDEPMT GQCNLVVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIE 128
            RLGDYLIE
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 66. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 194.5 bits 684,  Expect = 8e-52
 Identities = 90/130 69%, Positives = 111/130 85%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQ YVDEHLMC+++GH L +AAI+GHDG+ WAQS  FPE+K  ++  I+ DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGG+T+KK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 67. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 192.8 bits 678,  Expect = 3e-51
 Identities = 94/130 72%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVD+HLMCD++G    LT AAILG DGSVWAQSA FP++KP EI AI+ +F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ G KYMVIQGE G VIRGKKG GG+ +KK+  ALIFG+YDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 68. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 190.6 bits 670,  Expect = 1e-50
 Identities = 93/130 71%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDG--HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQ YVDEHLMCD++G  + LTSAAILG DG+VWAQSA FP++KP E+  I+ +F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTGM+I GAKYMV+QGEPG VIRGKKG+GG+ IKK+  A+I G+YDEP+ PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 69. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 190.6 bits 670,  Expect = 1e-50
 Identities = 91/130 70%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDG--HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVD+HLMC+++G  + L++AAILG DGSVWAQSA FP++KP EI+A++ DF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ G KYMVIQGEPG VIRGKKG GG+ +KK+  ALI G+YDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 70. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 190.4 bits 669,  Expect = 1e-50
 Identities = 92/130 70%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDG--HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVD+HLMCD++G  + LTSAAI+G DG+VWA+SA FPE+KP EI AI+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
             LAPTG+++ GAKYMVIQGE G VIRGKKG+GG+ IKK+  A++FG+YDEP+ PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 71. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 188.4 bits 662,  Expect = 5e-50
 Identities = 91/130 70%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDG--HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVD+HLMC+++G  + LT+AAILG DGSVWAQSA FP++KP EI+A++ +F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ G KYMVIQGE G VIRGKKG GG+ +KK+  ALIFG+YDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 72. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 188.4 bits 662,  Expect = 5e-50
 Identities = 89/130 68%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMDG--HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            M WQTYVD+HLMC+++G  + L+ AAILG DGSVWAQSA FP++KP EI A++ DF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ G KYMVIQGEPG  IRGKKG GG+ +KK+  AL+FG+YDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 186.2 bits 654,  Expect = 2e-49
 Identities = 92/130 70%, Positives = 112/130 86%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCDMD--GHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQ YVDEHLMC+++  G+ LTS+AI+G DGS+WAQS+ FP++KP EI AI  +F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ G KYMVIQGEPG VIRGKKG GGV IKK+  ALIFG+YDEP+ PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 182.4 bits 640,  Expect = 4e-48
 Identities = 86/129 66%, Positives = 113/129 87%, Gaps = 2/129 1%
Query  1    MSWQTYVDEHLMCDMDG--HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
            MSWQTYVD+HLMCD++G  + LT+AAILG DG+VWA+S  FPE+KP E+  I+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
            +LAPTG+++ GAKYMV+QGE G VIRGKKG+GG+ IKK+  A++ G+YDEP+ PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQ 129
            VERLGDYL++Q
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 169.9 bits 594,  Expect = 2e-44
 Identities = 81/109 74%, Positives = 99/109 90%, Gaps = 0/109 0%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
            MSWQTYVD+HLMC+++G+ LTSAAI+G+DGS+WAQSA FP++KP EITAI+NDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEP 109
            APTG+Y+ G KYMVIQGE G VIRGKKG GGVT+KK+N ALI G+YDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 139.7 bits 485,  Expect = 3e-35
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 28/131 21%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPE------------------- 41
            MSWQTYVD+HLMCD++GH L SAAILG DGSVWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------LKPAEITAILNDFNEPGSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGV 92
                     +KP EIT I+ DF+EPG LAPTG+++ G KYMVIQGEPG VIRGKKGS G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKSNMALIFGLYDEPMTPGQCNLVVERLGDYLIEQGY 131
            TIKK+  ALIFG+Y+EP+TPGQCN+VVE++GDYL++QGY
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 76.2 bits 254,  Expect = 3e-16
 Identities = 49/127 38%, Positives = 76/127 59%, Gaps = 8/127 6%
Query  1    MSWQTYVDEHLMCDMDGHVLTSAAILG-HDGSVWAQ-SAGFP-ELKPAEITAILNDF-NE 56
            MSWQ+YVD ++   +D  +   A I G +DG+VWA+    +P ++   E+  I +   + 
Sbjct  1    MSWQSYVDNQICQHVDCRL---AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCN 116
            P S+   G+++ G KY+ IQ +  +V RG+KGS  + I  +N  L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQADNSLV-RGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  LVVERLGDYLIEQGY 131
             VVE+LGDYL    Y
Sbjct  117  NVVEKLGDYLKANNY 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.