The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL
APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE
RLGDYLLEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
P35081 Zea m 12.0101 131 894 245.2 4.3e-67
P35082 Zea m 12.0102 131 831 228.4 5e-62
Q9M7N0 Hev b 8.0201 131 824 226.5 1.8e-61
Q9FUD1 Ory s 12.0101 131 822 226.0 2.6e-61
P35083 Zea m 12.0103 131 819 225.2 4.6e-61
O04725 Cyn d 12 131 814 223.8 1.2e-60
O24650 Phl p 12.0102 131 803 220.9 8.9e-60
P35079 Phl p 12.0101 131 796 219.0 3.2e-59
CAA54686 Phl p 12.0101 131 796 219.0 3.2e-59
Q9M7M8 Hev b 8.0203 131 793 218.2 5.7e-59
A0A2I4DNN6 Jug r 7.0101 131 792 218.0 6.8e-59
Q9LEI8 Hev b 8.0204 131 786 216.4 2.1e-58
O24282 Phl p 12.0103 131 786 216.4 2.1e-58
O22655 Zea m 12.0104 131 781 215.0 5.2e-58
Q9M7M9 Hev b 8.0202 131 779 214.5 7.5e-58
AAL07320 Lit c 1 131 776 213.7 1.3e-57
P52184 Hor v 12.0101 131 775 213.4 1.6e-57
FM164277 Tri a 12.0104 131 765 210.8 1e-56
Q9FR39 Zea m 12.0105 131 765 210.8 1e-56
Q8L5D8 Pho d 2.0101 131 764 210.5 1.2e-56
P49232 Tri a 12.0101 138 764 210.5 1.3e-56
P49233 Tri a 12.0102 141 764 210.4 1.4e-56
Q9XF38 Pyr c 4 131 762 210.0 1.8e-56
AAL92870 Che a 2 131 758 208.9 3.7e-56
AAL29690 Lyc e 1 131 756 208.4 5.3e-56
O65812 Hev b 8.0101 131 755 208.1 6.4e-56
O24169 Ole e 2 134 755 208.1 6.6e-56
O24170 Ole e 2 134 755 208.1 6.6e-56
AAL76933 Dau c 4 134 755 208.1 6.6e-56
Q9XF40 Mal d 4 131 754 207.8 7.7e-56
P49234 Tri a 12.0103 140 752 207.2 1.2e-55
AF377948 Mus a 1.0101 131 750 206.8 1.6e-55
Q9XF42 Mal d 4 131 750 206.8 1.6e-55
O24171 Ole e 2 134 750 206.7 1.7e-55
O65809 Gly m 3 131 749 206.5 1.9e-55
Q9XF37 Api g 4 134 749 206.5 2e-55
CAD10376 Cap a 2 131 747 205.9 2.8e-55
QID21357 Pop n 2.0101 131 746 205.7 3.4e-55
O65810 Gly m 3 131 746 205.7 3.4e-55
Q9AXH4 Cor a 2 131 745 205.4 4.1e-55
AAP13533 Cuc m 2 131 745 205.4 4.1e-55
O49894 Mer a 1 133 745 205.4 4.2e-55
AAK54835 Ana c 1 131 744 205.1 4.9e-55
CAD37201 Pru p 4.0101 131 744 205.1 4.9e-55
AY081850 Pru du 4.0101 131 743 204.9 5.9e-55
AY081852 Pru du 4.0102 131 743 204.9 5.9e-55
CAD37202 Pru p 4.0201 131 742 204.6 7.1e-55
AAK01235 Cor a 2 131 739 203.8 1.2e-54
Q9XF41 Mal d 4 131 739 203.8 1.2e-54
Q9STB6 Hev b 8.0102 131 737 203.3 1.8e-54
Q9XF39 Pru av 4 131 737 203.3 1.8e-54
ACP43298 Ama r 2.0101 133 737 203.3 1.8e-54
Q5XWE1 Citr l 2.0101 131 735 202.7 2.6e-54
A0A023W2L7 Pro j 2.0101 133 735 202.7 2.6e-54
CAD10377 Lyc e 1 131 732 201.9 4.5e-54
Q93YG7 Sola l 1.0101 131 732 201.9 4.5e-54
QVU02258 Que ac 2.0101 133 732 201.9 4.6e-54
XP030492464 Can s 2.0101 133 730 201.4 6.7e-54
Q9SQI9 Ara h 5 131 727 200.6 1.1e-53
P25816 Bet v 2 133 727 200.6 1.2e-53
Q5EF31 Cro s 1.0101 131 724 199.8 2e-53
A0A0A0REA1 Koc s 2.0101 133 723 199.5 2.4e-53
P84177 Cit s 2.0101 131 721 199.0 3.5e-53
A0A0A0RCW1 Aca f 2 133 719 198.5 5.1e-53
O81982 Hel a 2 133 716 197.7 8.9e-53
ACS34771 Sal k 4.0101 133 712 196.6 1.9e-52
Q9XG85 Par j 3 132 709 195.8 3.2e-52
QRN65366 Lig v 2.0101 134 708 195.5 4e-52
AJ421030 Art v 4.0101 133 705 194.7 6.8e-52
ABU95412 Sin a 4.0101 131 704 194.5 8e-52
Q9T0M8 Par j 3 131 702 193.9 1.2e-51
Q42449 Ara t 8 131 688 190.2 1.5e-50
ADK22841 Sal k 4.0201 133 687 189.9 1.9e-50
AJ421031 Art v 4.0201 133 681 188.3 5.8e-50
FG438715 Act d 9.0101 109 616 171.1 7.2e-45
QEQ43417 Sola m 1.0101 159 518 144.7 9.4e-37
A0A1B2YLJ4 Tyr p 36.0101 131 247 72.5 4.2e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 245.2 bits 894,  Expect = 4e-67
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 2. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 228.4 bits 831,  Expect = 5e-62
 Identities = 118/131 90%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHL +AAIVGHDGA WAQSTAFPEFK E+MA IMKDFDEPGHL
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 226.5 bits 824,  Expect = 2e-61
 Identities = 115/131 87%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMC+I+GHHLT+AAI+GHDG+ WAQS++FP+FKPEE+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 4. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 226.0 bits 822,  Expect = 3e-61
 Identities = 116/131 88%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHLTSAAIVGHDG  WAQS AFP+FKPEEM  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 5. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 225.2 bits 819,  Expect = 5e-61
 Identities = 116/131 88%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL+SAAIVGHDGA WAQSTAFP+FKPEEM  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+L+IGIYDEPMTPGQCN+VVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 223.8 bits 814,  Expect = 1e-60
 Identities = 113/131 86%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEGHHLTSAAI+GHDG  WAQS AFP FKPEEMA IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKTGQ+L+IGIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLLEQGM 131
            +LGDYL+EQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 7. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 220.9 bits 803,  Expect = 9e-60
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDG  WAQS  FP+FKPEE+  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG+GGIT+KKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 8. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 219.0 bits 796,  Expect = 3e-59
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDG  WAQS  FP+FKPEE+  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG+GGIT+KKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 9. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 219.0 bits 796,  Expect = 3e-59
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDG  WAQS  FP+FKPEE+  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG+GGIT+KKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 218.2 bits 793,  Expect = 6e-59
 Identities = 110/131 83%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+ WAQS+ FP+FK +E+AA+MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 11. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 218.0 bits 792,  Expect = 7e-59
 Identities = 110/131 83%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEI+G+HLT+AAI+GHDG+ WAQS++FP+FKPEE+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG+GGITVKKTGQ+LI GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 12. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 216.4 bits 786,  Expect = 2e-58
 Identities = 108/131 82%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+ WAQS++FP+FK +E+AA+MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLL+QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 13. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 216.4 bits 786,  Expect = 2e-58
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL SAAI GHDG  WAQS  FP+FKPEE+  IMKD+DEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTG+ +   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 14. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 215.0 bits 781,  Expect = 5e-58
 Identities = 108/130 83%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEG+HL++AAIVGHDG+ WAQS +FPE+KPEE+A I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG+GGIT+KKTG SLIIG+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 15. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 214.5 bits 779,  Expect = 8e-58
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+ WAQS++FP+FK +E+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 16. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 213.7 bits 776,  Expect = 1e-57
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMCE +G+HLT+AAI+GHDG+ WAQS  FP+FKP E+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GGITVKKT Q+LIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 17. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 213.4 bits 775,  Expect = 2e-57
 Identities = 108/130 83%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HLTSAAI+GHDG  W QS  FP+FKPEE+A I+KDFDEPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG  LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 18. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 210.8 bits 765,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSW+ YVD+HL CEI+G+HLTSAAI+GHDG+ WAQS  FP+FKPEE+A I+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 19. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 210.8 bits 765,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HL+C+IEG+HL++AAIVGHDG+ WAQS  FPE+KPEE+A ++KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG+GGIT+KKTG SLIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 20. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 210.5 bits 764,  Expect = 1e-56
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVDEHLMCEI+GHHLT+AAI+GHDG+ WAQS++FP+FK EE+  IM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT Q+LI GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 21. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 210.5 bits 764,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HLTSAAI+GHDG+ W +S  FP+FKPEE+A I+KDF+EPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 210.4 bits 764,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HL CEI+G+HLTSAAI+GHDG+ WA+S  FP+FKPEE+A I+KDF+EPGHL
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 23. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 210.0 bits 762,  Expect = 2e-56
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+GHHLT+AAI+GHDG+ WAQS+ FP+FKPEE+ AIMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKT Q+L+ GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 24. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 208.9 bits 758,  Expect = 4e-56
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMC+IEG+HL+SAAI+GHDG  WAQS +FP++KPEE++AIMKDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+T+KKT Q+LIIGIY EPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            R+GDYL+EQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 25. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 208.4 bits 756,  Expect = 5e-56
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMC+IEG+HLTSAAI+G+DG+ WAQS  FP+FKPEE+ AIM DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG+GGITVKKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 26. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 208.1 bits 755,  Expect = 6e-56
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDE LMCEIEG+HLT+AAI+G+DG+ WAQS+ FP+FK EE+ AIM DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GG+TV+KT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 27. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 208.1 bits 755,  Expect = 7e-56
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+ WAQS  FP+FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VVERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 28. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 208.1 bits 755,  Expect = 7e-56
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+ WAQS  FP+FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VVERLGDYLLEQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 29. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 208.1 bits 755,  Expect = 7e-56
 Identities = 102/131 77%, Positives = 124/131 94%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGH---HLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
            MSWQTYVD+HLMCE++G+   +L++AAI+GHDG+ WAQS+ FP+FKPEE+  IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGEP AVIRGKKGSGG+T+KKTGQ+L+ G+YDEP+TPGQCNL
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLLEQGM 131
            +VERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 30. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 207.8 bits 754,  Expect = 8e-56
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+ LMC+I+GHHLT+AAI+GHDG+ WA+S+ FP+FKPEE+ AIMKDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGG+TVKKTGQ+L+ GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 31. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 207.2 bits 752,  Expect = 1e-55
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSW+ YVD+HL CEI+G++LTSAAI+GHDG+ WAQS  FP+FKPEE A I+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 32. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 206.8 bits 750,  Expect = 2e-55
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HL+C+I+G+ LT+AAIVGHDG+ WAQS AFP+ KPEE+AAIMKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGG+T+KKT  +LIIGIY+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 33. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 206.8 bits 750,  Expect = 2e-55
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS +FP FKPEE+AAI+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGGIT+KKT Q+L+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 34. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 206.7 bits 750,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+ WAQS  FP+FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            V ERLGDYLLEQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 35. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 206.5 bits 749,  Expect = 2e-55
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HL+C+IEG+HLT AAI+G+DG+ WAQST FP+FKPEE+ AIM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG +LIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 36. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 206.5 bits 749,  Expect = 2e-55
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
            MSWQ YVD+HLMCE+EG+    LT+AAI+GHDG+ WAQS+ FP+ KPEE+A IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
            GHLAPTGL LGG KYMVIQGEP AVIRGKKGSGG+T+KKTGQ+L+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLLEQGM 131
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 37. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 205.9 bits 747,  Expect = 3e-55
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMCEIEG+ LTSAAI+G+DG+ WAQS  FP+FKPEE+ AIM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKG GGITVKKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 38. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 205.7 bits 746,  Expect = 3e-55
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+IEG+ LTSAAI+GHDG+ WA S +FP+F  EE++AIMKDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKGSGG+TVKKT Q+LIIG+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 39. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 205.7 bits 746,  Expect = 3e-55
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HL+C IEG+HLT AAI+G+DG+ W QST FP+FKPEE+ AIM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG +LIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ Y DEHLMCEIEG+ L +AAI+GHDG+ WAQS+ FP++KPEE+  +M DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 41. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEG+HLTSAAI+G+DG+ WAQS  FP++KPEE+A I+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL +GGTKYMVIQGEPGAVIRGKKG GG+TVKKTG +L+IGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 42. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVD+HLMC+I+G+  HL +A+IVGHDG+ WAQS +FP++KPEE+  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
            HLAPTGL + GTKYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 43. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 205.1 bits 744,  Expect = 5e-55
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMCEI+G+HL+SAAI+GHD   WAQS  FP+FKPEE++AI+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGITVKKT  +LIIG+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 44. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 205.1 bits 744,  Expect = 5e-55
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS  FP FKPEE+AAI+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGITVKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 45. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 204.9 bits 743,  Expect = 6e-55
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS  FP FKPEE+AAI+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGITVKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 204.9 bits 743,  Expect = 6e-55
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS  FP FKPEE+AAI+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGITVKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 47. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 204.6 bits 742,  Expect = 7e-55
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GHDG+ WAQS  FP++KPEE+  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKK+  +L+IGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 48. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 203.8 bits 739,  Expect = 1e-54
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTY DEHLMCEIEG+ L +AAI+GHDG+ WAQS+ FP++KPEE+  +M DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGAVIR KKG GG+TVKKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 49. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 203.8 bits 739,  Expect = 1e-54
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+ WAQS  FP++KPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TVKK+  +L+IGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 50. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 203.3 bits 737,  Expect = 2e-54
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+G+DG+ WAQS  FP+FK EE+  IM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL +GGTKYMVIQGEPGAVIRGKKG GG+TVKKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 51. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 203.3 bits 737,  Expect = 2e-54
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS  FP FKPEE+AAI+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGITVKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 52. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 203.3 bits 737,  Expect = 2e-54
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQ YVD+HLMCEIEG  +HLT AAI+G DG+ WAQS  FP+FKP+E+AAI++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPGAVIRGKKG+GGI VKKTGQ+L++GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 53. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 202.7 bits 735,  Expect = 3e-54
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HLTSAAI+G+DG+ WA+S  FP++KPEE+  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL +GG+KYMVIQGEPGAVIRGKKG GG+TVKKT  +L+IGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 54. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 202.7 bits 735,  Expect = 3e-54
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HL++AAI+G DG+ WAQS +FP+FKP+E++A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI VKKTGQ+LIIGIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 201.9 bits 732,  Expect = 5e-54
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHL+CE EG+HLTSAAI+G+DG  WAQS  FP+FKPEE+  IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEP AVIRGKKG GGIT+KKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 56. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 201.9 bits 732,  Expect = 5e-54
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHL+CE EG+HLTSAAI+G+DG  WAQS  FP+FKPEE+  IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEP AVIRGKKG GGIT+KKT Q+LIIGIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 57. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 201.9 bits 732,  Expect = 5e-54
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HL +AAI+GHDG+ WAQS+ FP+FK EE++ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
            HLAPTGL LGGTKYMVIQGE GAVIRGKKGSGG+T+KKT Q+L+ GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 58. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 201.4 bits 730,  Expect = 7e-54
 Identities = 101/131 77%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HLT+AAI+GHDG+ WAQS++FP++K +E+  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
            HLAPTGL L GTKYMVIQGEPGAVIRGKKGSGG+T+KKTGQ+LI GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 59. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 200.6 bits 727,  Expect = 1e-53
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD HL+CEIEG HL+SAAI+G+DG  WAQS+ FP+FKPEE+ AIM DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPGA+I GKKG GG+T++KT Q+LIIGIYD+PMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 60. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 200.6 bits 727,  Expect = 1e-53
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGHHLTS--AAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+   S  +AIVGHDG+ WAQS++FP+FKP+E+  IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
            HLAPTGL LGG KYMVIQGE GAVIRGKKGSGGIT+KKTGQ+L+ GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 61. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 199.8 bits 724,  Expect = 2e-53
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVDEHLMC+++GH LTSAAI+GHDG+ WAQS  FPE+KP E+ AI+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKGSGG+T+KK+  +LI G+YDEPMTPGQCNLVVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 62. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 199.5 bits 723,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HLT AAI+G DG+ WAQS  FP+FKP+E+AAI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI VKKTGQ+LI GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 63. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 199.0 bits 721,  Expect = 3e-53
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+ W+QS  FP F+ EE+AAI+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE GAVIRGKKGSGGI VKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 64. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 198.5 bits 719,  Expect = 5e-53
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            M WQTYVD+HLMCEIEG  +HL+ AAI+G DG+ WAQS +FP+FKP+E+AA++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG  IRGKKG GGI VKKTGQ+L+ GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 65. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 197.7 bits 716,  Expect = 9e-53
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQ YVDEHLMC+IEG  +HLTSAAI+G DG  WAQS  FP+FKPEEM  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTG+ + G KYMV+QGEPGAVIRGKKG+GGI +KKTGQ++I+GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLLEQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 66. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 196.6 bits 712,  Expect = 2e-52
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HLT+AAI+G DG+ WAQS  FP+FKP+E++A++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI VKKTGQ+LI GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 67. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 195.8 bits 709,  Expect = 3e-52
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGH 59
            MSWQ YVD+HLMC++ +G+   SAAI+GHDG+ WAQS  FP++KPEE+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQ+++IGIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 68. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 195.5 bits 708,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+ WAQS  FP+FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE GAVIRGKKGSGGIT+KKT Q+L+ GIY+EP+TPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VV RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 69. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 194.7 bits 705,  Expect = 7e-52
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HLTSAAI G DG  WA+S +FPEFKP E+ AI+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
            +LAPTGL LGG KYMVIQGE GAVIRGKKG+GGI +KKTGQ+++ GIYDEP+ PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLL+QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 70. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 194.5 bits 704,  Expect = 8e-52
 Identities = 95/131 72%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMC++EG+ LT+AAI+G+DG+ WAQS  FP++KPEE+  I  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL +GGTKYMVIQGEP AVIRGKKG+GG+T+KKT Q+++ GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 71. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 193.9 bits 702,  Expect = 1e-51
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGH 59
            MSWQ YVD+HLMC++ +G+ L SAAI+GHDG+ WAQS  FP++KPEE+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVV 119
            LAPTGL LGGTKYMVIQGE GAVI GKKGSGG T+KKTGQ+++IGIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 72. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 190.2 bits 688,  Expect = 2e-50
 Identities = 94/128 73%, Positives = 113/128 88%, Gaps = 0/128 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQ+YVD+HLMC++EG+HLT+AAI+G+DG+ WAQS  FP++KP+E+  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
            APTGL LGG KYMVIQGE GAVIRGKKG GG+T+KKT Q+L+ G YDEPMT GQCNLVVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLLE 128
            RLGDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 189.9 bits 687,  Expect = 2e-50
 Identities = 98/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQ YVDEHLMC IE  G+HLTS+AIVG DG+ WAQS+ FP+ KP+E+ AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGG KYMVIQGEPGAVIRGKKG GG+ +KKT Q+LI GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 188.3 bits 681,  Expect = 6e-50
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HLT+AAI+G DG  WA+S  FPEFKPEEM  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
             LAPTGL LGG KYMV+QGE GAVIRGKKG+GGI +KKTGQ++++GIYDEP+ PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 171.1 bits 616,  Expect = 7e-45
 Identities = 88/109 80%, Positives = 99/109 90%, Gaps = 0/109 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
            MSWQTYVD+HLMCEIEG++LTSAAI+G+DG+ WAQS +FP+FKPEE+ AIM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEP 109
            APTGL LGGTKYMVIQGE GAVIRGKKG GG+TVKKT Q+LIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 144.7 bits 518,  Expect = 9e-37
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 28/130 21%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPE------------------- 41
            MSWQTYVD+HLMC++EGHHL SAAI+G DG+ WAQS AFP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEMAAIMKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGI 92
                     FKPEE+  IMKDFDEPG LAPTGL LGGTKYMVIQGEPGAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLLEQG 130
            T+KKTGQ+LI GIY+EP+TPGQCN+VVE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 72.5 bits 247,  Expect = 4e-15
 Identities = 48/122 39%, Positives = 71/122 58%, Gaps = 8/122 6%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVG-HDGATWAQ-STAFP-EFKPEEMAAIMKDF-DE 56
            MSWQ+YVD ++ C+     L  A I G +DGA WA+    +P +   +E+  I       
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCN 116
            P  +   G+ LGG KY+ IQ +  +++RG+KGS  + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  LVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.