The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9FUD1 Ory s 12.0101 131 900 256.7 1.5e-70
P35083 Zea m 12.0103 131 875 249.8 1.8e-68
O04725 Cyn d 12 131 867 247.5 8.5e-68
P35082 Zea m 12.0102 131 831 237.5 8.8e-65
O24650 Phl p 12.0102 131 825 235.9 2.8e-64
P35081 Zea m 12.0101 131 822 235.0 5e-64
P35079 Phl p 12.0101 131 818 233.9 1.1e-63
CAA54686 Phl p 12.0101 131 818 233.9 1.1e-63
O24282 Phl p 12.0103 131 817 233.6 1.3e-63
Q9M7N0 Hev b 8.0201 131 812 232.2 3.4e-63
A0A2I4DNN6 Jug r 7.0101 131 794 227.2 1.1e-61
Q8L5D8 Pho d 2.0101 131 793 226.9 1.3e-61
AAL07320 Lit c 1 131 784 224.4 7.6e-61
Q9M7M8 Hev b 8.0203 131 781 223.6 1.4e-60
Q9LEI8 Hev b 8.0204 131 780 223.3 1.6e-60
O22655 Zea m 12.0104 131 777 222.5 2.9e-60
Q9M7M9 Hev b 8.0202 131 776 222.2 3.6e-60
AAL29690 Lyc e 1 131 774 221.7 5.2e-60
Q9XF38 Pyr c 4 131 770 220.5 1.1e-59
P52184 Hor v 12.0101 131 769 220.3 1.4e-59
CAD37202 Pru p 4.0201 131 768 220.0 1.7e-59
CAD10376 Cap a 2 131 767 219.7 2e-59
AAL92870 Che a 2 131 765 219.2 3e-59
Q9AXH4 Cor a 2 131 763 218.6 4.4e-59
Q9XF41 Mal d 4 131 763 218.6 4.4e-59
QID21357 Pop n 2.0101 131 763 218.6 4.4e-59
CAD10377 Lyc e 1 131 762 218.3 5.3e-59
Q93YG7 Sola l 1.0101 131 762 218.3 5.3e-59
Q9XF40 Mal d 4 131 762 218.3 5.3e-59
O24169 Ole e 2 134 762 218.3 5.4e-59
Q9STB6 Hev b 8.0102 131 761 218.0 6.4e-59
Q9FR39 Zea m 12.0105 131 761 218.0 6.4e-59
FM164277 Tri a 12.0104 131 760 217.8 7.8e-59
O24170 Ole e 2 134 760 217.8 8e-59
AAP13533 Cuc m 2 131 758 217.2 1.1e-58
Q5XWE1 Citr l 2.0101 131 758 217.2 1.1e-58
AAK01235 Cor a 2 131 757 216.9 1.4e-58
O49894 Mer a 1 133 756 216.7 1.7e-58
AAL76933 Dau c 4 134 756 216.6 1.7e-58
O65812 Hev b 8.0101 131 755 216.4 2e-58
O65809 Gly m 3 131 755 216.4 2e-58
O24171 Ole e 2 134 755 216.4 2.1e-58
P49232 Tri a 12.0101 138 755 216.4 2.2e-58
P49233 Tri a 12.0102 141 755 216.4 2.2e-58
Q9XF42 Mal d 4 131 754 216.1 2.5e-58
CAD37201 Pru p 4.0101 131 752 215.5 3.6e-58
O65810 Gly m 3 131 752 215.5 3.6e-58
AY081850 Pru du 4.0101 131 751 215.3 4.4e-58
AY081852 Pru du 4.0102 131 751 215.3 4.4e-58
AAK54835 Ana c 1 131 750 215.0 5.4e-58
AF377948 Mus a 1.0101 131 747 214.1 9.6e-58
P49234 Tri a 12.0103 140 747 214.1 1e-57
Q9XF37 Api g 4 134 746 213.9 1.2e-57
Q9XF39 Pru av 4 131 745 213.6 1.4e-57
A0A023W2L7 Pro j 2.0101 133 745 213.6 1.4e-57
ACP43298 Ama r 2.0101 133 745 213.6 1.4e-57
QVU02258 Que ac 2.0101 133 743 213.0 2.1e-57
XP030492464 Can s 2.0101 133 743 213.0 2.1e-57
Q9XG85 Par j 3 132 737 211.4 6.6e-57
Q9SQI9 Ara h 5 131 736 211.1 8e-57
P25816 Bet v 2 133 736 211.1 8.1e-57
O81982 Hel a 2 133 732 210.0 1.8e-56
ABU95412 Sin a 4.0101 131 730 209.4 2.5e-56
P84177 Cit s 2.0101 131 729 209.1 3.1e-56
A0A0A0REA1 Koc s 2.0101 133 727 208.6 4.6e-56
QRN65366 Lig v 2.0101 134 726 208.3 5.6e-56
Q5EF31 Cro s 1.0101 131 725 208.0 6.7e-56
A0A0A0RCW1 Aca f 2 133 725 208.0 6.8e-56
Q9T0M8 Par j 3 131 724 207.8 8.1e-56
ACS34771 Sal k 4.0101 133 722 207.2 1.2e-55
Q42449 Ara t 8 131 718 206.1 2.6e-55
AJ421030 Art v 4.0101 133 704 202.2 3.9e-54
ADK22841 Sal k 4.0201 133 699 200.8 1e-53
AJ421031 Art v 4.0201 133 692 198.8 3.9e-53
FG438715 Act d 9.0101 109 628 181.1 7.2e-48
QEQ43417 Sola m 1.0101 159 549 159.0 4.6e-41
A0A1B2YLJ4 Tyr p 36.0101 131 245 74.5 1.1e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 256.7 bits 900,  Expect = 1e-70
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 2. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 249.8 bits 875,  Expect = 2e-68
 Identities = 125/131 95%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAIVGHDG VWAQS AFPQFKPEEMTNI+KDFDEPGFL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            AP GLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 3. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 247.5 bits 867,  Expect = 9e-68
 Identities = 120/131 91%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHLTSAAI+GHDGTVWAQSAAFP FKPEEM NIMKDFDEPGFL
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGG+TVKKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLVEQGL 131
            +LGDYL+EQG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 4. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 237.5 bits 831,  Expect = 9e-65
 Identities = 118/131 90%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVDEHLMCEIEGHHL +AAIVGHDG  WAQS AFP+FK E+M NIMKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 5. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 235.9 bits 825,  Expect = 3e-64
 Identities = 117/131 89%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDGTVWAQSA FPQFKPEE+T IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 6. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 235.0 bits 822,  Expect = 5e-64
 Identities = 116/131 88%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHLTSAAIVGHDG  WAQS AFP+FKPEEM  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 233.9 bits 818,  Expect = 1e-63
 Identities = 116/131 88%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDGTVWAQSA FPQFKPEE+T IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPG VIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 8. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 233.9 bits 818,  Expect = 1e-63
 Identities = 116/131 88%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDGTVWAQSA FPQFKPEE+T IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPG VIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 9. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 233.6 bits 817,  Expect = 1e-63
 Identities = 116/131 88%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL SAAI GHDGTVWAQSA FPQFKPEE+T IMKD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 10. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 232.2 bits 812,  Expect = 3e-63
 Identities = 112/131 85%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMC+I+GHHLT+AAI+GHDG+VWAQS++FPQFKPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 11. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 227.2 bits 794,  Expect = 1e-61
 Identities = 112/131 85%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMCEI+G+HLT+AAI+GHDG+VWAQS++FPQFKPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKG+GGITVKKTGQAL+ GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 12. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 226.9 bits 793,  Expect = 1e-61
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVDEHLMCEI+GHHLT+AAI+GHDG+VWAQS++FPQFK EE+TNIM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 13. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 224.4 bits 784,  Expect = 8e-61
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMCE +G+HLT+AAI+GHDG+VWAQSA FPQFKP E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLV+QGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 14. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 223.6 bits 781,  Expect = 1e-60
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+VWAQS+ FPQFK +E+  +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 15. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 223.3 bits 780,  Expect = 2e-60
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+VWAQS++FPQFK +E+  +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 16. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 222.5 bits 777,  Expect = 3e-60
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVDEHLMCEIEG+HL++AAIVGHDG+VWAQS +FP++KPEE+  I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 17. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 222.2 bits 776,  Expect = 4e-60
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+VWAQS++FPQFK +E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 18. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 221.7 bits 774,  Expect = 5e-60
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMC+IEG+HLTSAAI+G+DG+VWAQSA FPQFKPEE+T IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKG+GGITVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDY++EQGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 19. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 220.5 bits 770,  Expect = 1e-59
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+GHHLT+AAI+GHDG+VWAQS+ FP+FKPEE+T IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGG+TVKKT QALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 20. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 220.3 bits 769,  Expect = 1e-59
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HL CEI+G+HLTSAAI+GHDG VW QS  FPQFKPEE+  I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 21. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 220.0 bits 768,  Expect = 2e-59
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GHDG+VWAQSA FPQ+KPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKK+  AL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 22. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 219.7 bits 767,  Expect = 2e-59
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMCEIEG+ LTSAAI+G+DG+VWAQSA FPQFKPEE+T IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 23. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 219.2 bits 765,  Expect = 3e-59
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMC+IEG+HL+SAAI+GHDGTVWAQS +FPQ+KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG GG+T+KKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            R+GDYLVEQG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 24. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 218.6 bits 763,  Expect = 4e-59
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ Y DEHLMCEIEG+ L +AAI+GHDG+VWAQS+ FPQ+KPEE+T +M DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 25. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 218.6 bits 763,  Expect = 4e-59
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+VWAQSA FPQ+KPEE+T IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GG+TVKK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 26. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 218.6 bits 763,  Expect = 4e-59
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+IEG+ LTSAAI+GHDG+VWA SA+FPQF  EE++ IMKDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL++G+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 27. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 218.3 bits 762,  Expect = 5e-59
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHL+CE EG+HLTSAAI+G+DGTVWAQSA FPQFKPEE+T IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 28. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 218.3 bits 762,  Expect = 5e-59
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHL+CE EG+HLTSAAI+G+DGTVWAQSA FPQFKPEE+T IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 29. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 218.3 bits 762,  Expect = 5e-59
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+ LMC+I+GHHLT+AAI+GHDG+VWA+S+ FP+FKPEE+T IMKDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGG+TVKKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 30. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 218.3 bits 762,  Expect = 5e-59
 Identities = 111/131 84%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+VWAQSA FPQFKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            VVERLGDYLVEQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 31. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 218.0 bits 761,  Expect = 6e-59
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+G+DG+VWAQSA FPQFK EE+T IM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 32. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 218.0 bits 761,  Expect = 6e-59
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HL+C+IEG+HL++AAIVGHDG+VWAQS  FP++KPEE+  ++KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 33. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 217.8 bits 760,  Expect = 8e-59
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSW+ YVD+HL CEI+G+HLTSAAI+GHDG+VWAQS  FPQFKPEE+  I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 34. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 217.8 bits 760,  Expect = 8e-59
 Identities = 111/131 84%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+VWAQSA FPQFKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            VVERLGDYL+EQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 35. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 217.2 bits 758,  Expect = 1e-58
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVDEHLMCEIEG+HLTSAAI+G+DG+VWAQS  FPQ+KPEE+  I+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 217.2 bits 758,  Expect = 1e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HLTSAAI+G+DG+VWA+S  FPQ+KPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL++G +KYMVIQGEPGAVIRGKKG GG+TVKKT  ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 216.9 bits 757,  Expect = 1e-58
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTY DEHLMCEIEG+ L +AAI+GHDG+VWAQS+ FPQ+KPEE+T +M DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIR KKG GG+TVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 38. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 216.7 bits 756,  Expect = 2e-58
 Identities = 106/131 80%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVD+HLMC+I+G+  HL +A+IVGHDG++WAQSA+FPQ+KPEE+T IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL++  TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 39. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 216.6 bits 756,  Expect = 2e-58
 Identities = 104/131 79%, Positives = 125/131 95%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGH---HLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
            MSWQTYVD+HLMCE++G+   +L++AAI+GHDG+VWAQS+ FP+FKPEE+T IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL+LG TKYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLVEQGL 131
            +VERLGDYL+EQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 40. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 216.4 bits 755,  Expect = 2e-58
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDE LMCEIEG+HLT+AAI+G+DG+VWAQS+ FPQFK EE+T IM DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKG GG+TV+KT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 41. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 216.4 bits 755,  Expect = 2e-58
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HL+C+IEG+HLT AAI+G+DG+VWAQS  FPQFKPEE+T IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 42. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 216.4 bits 755,  Expect = 2e-58
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+VWAQSA FPQFKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            V ERLGDYL+EQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 43. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 216.4 bits 755,  Expect = 2e-58
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HL CEI+G+HLTSAAI+GHDG+VW +S  FP+FKPEE+  I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 216.4 bits 755,  Expect = 2e-58
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HL CEI+G+HLTSAAI+GHDG+VWA+S  FP+FKPEE+  I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 45. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 216.1 bits 754,  Expect = 2e-58
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA+FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 215.5 bits 752,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 47. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 215.5 bits 752,  Expect = 4e-58
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HL+C IEG+HLT AAI+G+DG+VW QS  FPQFKPEE+T IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 48. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 215.3 bits 751,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 49. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 215.3 bits 751,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 50. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 215.0 bits 750,  Expect = 5e-58
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMCEI+G+HL+SAAI+GHD TVWAQS  FPQFKPEE++ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 51. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 214.1 bits 747,  Expect = 1e-57
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HL+C+I+G+ LT+AAIVGHDG+VWAQS AFPQ KPEE+  IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL +QG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 52. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 214.1 bits 747,  Expect = 1e-57
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSW+ YVD+HL CEI+G++LTSAAI+GHDG+VWAQS  FPQFKPEE   I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 53. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 213.9 bits 746,  Expect = 1e-57
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
            MSWQ YVD+HLMCE+EG+    LT+AAI+GHDG+VWAQS+ FPQ KPEE+  IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLVEQGL 131
            +VERLGDYL++QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 54. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 213.6 bits 745,  Expect = 1e-57
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA FP FKPEE+  I+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 55. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 213.6 bits 745,  Expect = 1e-57
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HL++AAI+G DG+VWAQSA+FPQFKP+E++ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPG VIRGKKG GGI VKKTGQAL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 56. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 213.6 bits 745,  Expect = 1e-57
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQ YVD+HLMCEIEG  +HLT AAI+G DG+VWAQSA FPQFKP+E+  I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPGAVIRGKKG+GGI VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 57. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 213.0 bits 743,  Expect = 2e-57
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HL +AAI+GHDG+VWAQS+ FPQFK EE+++IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLV+QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 58. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 213.0 bits 743,  Expect = 2e-57
 Identities = 104/131 79%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HLT+AAI+GHDG++WAQS++FPQ+K +E+T+I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL L  TKYMVIQGEPGAVIRGKKGSGG+T+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLV+QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 59. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 211.4 bits 737,  Expect = 7e-57
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGF 59
            MSWQ YVD+HLMC++ +G+   SAAI+GHDG+VWAQSA FPQ+KPEE+T IM DF+E GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
            LAPTGLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLVEQGL 131
            ERLGDYL+EQGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 60. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 211.1 bits 736,  Expect = 8e-57
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD HL+CEIEG HL+SAAI+G+DG VWAQS+ FPQFKPEE+T IM DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GG+T++KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++ GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 61. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 211.1 bits 736,  Expect = 8e-57
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGHHLTS--AAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+   S  +AIVGHDG+VWAQS++FPQFKP+E+T IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG  KYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 62. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 210.0 bits 732,  Expect = 2e-56
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQ YVDEHLMC+IEG  +HLTSAAI+G DGTVWAQSA FPQFKPEEM  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+F+   KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 63. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 209.4 bits 730,  Expect = 3e-56
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMC++EG+ LT+AAI+G+DG+VWAQSA FPQ+KPEE+  I  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEP AVIRGKKG+GG+T+KKT QA+V GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 64. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 209.1 bits 729,  Expect = 3e-56
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ LT+AAI+G+DG+VW+QSA FP F+ EE+  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGI VKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 65. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 208.6 bits 727,  Expect = 5e-56
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HLT AAI+G DG+VWAQSA FPQFKP+E+  I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 66. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 208.3 bits 726,  Expect = 6e-56
 Identities = 106/131 80%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    LT+AAIVGHDG+VWAQSA FPQFKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKT QALV GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            VV RLGD LV+QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 67. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 208.0 bits 725,  Expect = 7e-56
 Identities = 97/130 74%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVDEHLMC+++GH LTSAAI+GHDG+VWAQSA FP++KP E+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGG+T+KK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 68. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 208.0 bits 725,  Expect = 7e-56
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            M WQTYVD+HLMCEIEG  +HL+ AAI+G DG+VWAQSA+FPQFKP+E+  ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPG  IRGKKG GGI VKKTGQALV GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 69. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 207.8 bits 724,  Expect = 8e-56
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGF 59
            MSWQ YVD+HLMC++ +G+ L SAAI+GHDG+VWAQSA FPQ+KPEE+T IM DF+E GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
            LAPTGLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLVEQGL 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 207.2 bits 722,  Expect = 1e-55
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HLT+AAI+G DG+VWAQSA FPQFKP+E++ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 71. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 206.1 bits 718,  Expect = 3e-55
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQ+YVD+HLMC++EG+HLT+AAI+G+DG+VWAQSA FPQ+KP+E+  I KDF+EPGFL
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG  KYMVIQGE GAVIRGKKG GG+T+KKT QALV G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+E  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 202.2 bits 704,  Expect = 4e-54
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HLTSAAI G DGTVWA+SA+FP+FKP E+  I+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMVIQGE GAVIRGKKG+GGI +KKTGQA+V GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 200.8 bits 699,  Expect = 1e-53
 Identities = 100/131 76%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQ YVDEHLMC IE  G+HLTS+AIVG DG++WAQS+ FPQ KP+E+  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMVIQGEPGAVIRGKKG GG+ +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL+EQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 198.8 bits 692,  Expect = 4e-53
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HLT+AAI+G DGTVWA+S  FP+FKPEEM  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMV+QGE GAVIRGKKG+GGI +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLV+Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 181.1 bits 628,  Expect = 7e-48
 Identities = 88/109 80%, Positives = 101/109 92%, Gaps = 0/109 0%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
            MSWQTYVD+HLMCEIEG++LTSAAI+G+DG++WAQSA+FPQFKPEE+T IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEP 109
            APTGL+LG TKYMVIQGE GAVIRGKKG GG+TVKKT QAL++GIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 159.0 bits 549,  Expect = 5e-41
 Identities = 110/130 84%, Positives = 124/130 95%, Gaps = 28/130 21%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQ------------------- 41
            MSWQTYVD+HLMC++EGHHL SAAI+G DG+VWAQS AFP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGI 92
                     FKPEE+TNIMKDFDEPGFLAPTGLFLG TKYMVIQGEPGAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQG 130
            T+KKTGQAL+ GIY+EP+TPGQCNMVVE++GDYLV+QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.5 bits 245,  Expect = 1e-15
 Identities = 48/122 39%, Positives = 70/122 57%, Gaps = 8/122 6%
Query  1    MSWQTYVDEHLMCEIEGHHLTSAAIVG-HDGTVWAQ-SAAFP-QFKPEEMTNIMKDF-DE 56
            MSWQ+YVD ++ C+     L  A I G +DG VWA+    +P Q   +E+  I       
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCN 116
            P  +   G+ LG  KY+ IQ +  +++RG+KGS  + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.