The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL
APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE
RLGDYLIDTGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9SQI9 Ara h 5 131 898 237.2 1.1e-64
CAD10376 Cap a 2 131 785 208.2 6e-56
AAL29690 Lyc e 1 131 782 207.4 1e-55
Q9STB6 Hev b 8.0102 131 781 207.1 1.2e-55
O65809 Gly m 3 131 777 206.1 2.5e-55
Q93YG7 Sola l 1.0101 131 775 205.6 3.6e-55
CAD10377 Lyc e 1 131 775 205.6 3.6e-55
O65810 Gly m 3 131 774 205.4 4.3e-55
Q9AXH4 Cor a 2 131 766 203.3 1.8e-54
AAP13533 Cuc m 2 131 763 202.5 3e-54
AAL07320 Lit c 1 131 763 202.5 3e-54
AAK01235 Cor a 2 131 760 201.8 5.2e-54
CAD37202 Pru p 4.0201 131 760 201.8 5.2e-54
Q5XWE1 Citr l 2.0101 131 760 201.8 5.2e-54
AAL92870 Che a 2 131 759 201.5 6.2e-54
O65812 Hev b 8.0101 131 759 201.5 6.2e-54
Q9XF41 Mal d 4 131 755 200.5 1.3e-53
Q9M7N0 Hev b 8.0201 131 746 198.2 6.3e-53
Q8L5D8 Pho d 2.0101 131 746 198.2 6.3e-53
AAK54835 Ana c 1 131 744 197.6 8.9e-53
A0A2I4DNN6 Jug r 7.0101 131 740 196.6 1.8e-52
Q9FUD1 Ory s 12.0101 131 736 195.6 3.7e-52
O24650 Phl p 12.0102 131 736 195.6 3.7e-52
Q9XF38 Pyr c 4 131 735 195.3 4.4e-52
QID21357 Pop n 2.0101 131 734 195.1 5.3e-52
P35083 Zea m 12.0103 131 732 194.6 7.6e-52
Q9LEI8 Hev b 8.0204 131 730 194.0 1.1e-51
CAA54686 Phl p 12.0101 131 729 193.8 1.3e-51
P35079 Phl p 12.0101 131 729 193.8 1.3e-51
P35081 Zea m 12.0101 131 727 193.3 1.8e-51
ABU95412 Sin a 4.0101 131 726 193.0 2.2e-51
AF377948 Mus a 1.0101 131 722 192.0 4.5e-51
A0A023W2L7 Pro j 2.0101 133 722 192.0 4.6e-51
CAD37201 Pru p 4.0101 131 721 191.7 5.4e-51
Q9M7M8 Hev b 8.0203 131 721 191.7 5.4e-51
AY081850 Pru du 4.0101 131 720 191.5 6.4e-51
AY081852 Pru du 4.0102 131 720 191.5 6.4e-51
FM164277 Tri a 12.0104 131 719 191.2 7.7e-51
Q9XF40 Mal d 4 131 718 191.0 9.2e-51
O24282 Phl p 12.0103 131 717 190.7 1.1e-50
O04725 Cyn d 12 131 717 190.7 1.1e-50
Q9XF42 Mal d 4 131 717 190.7 1.1e-50
Q9M7M9 Hev b 8.0202 131 716 190.4 1.3e-50
Q9XF39 Pru av 4 131 714 189.9 1.9e-50
P49232 Tri a 12.0101 138 714 189.9 2e-50
P49233 Tri a 12.0102 141 714 189.9 2.1e-50
ACP43298 Ama r 2.0101 133 711 189.1 3.3e-50
P52184 Hor v 12.0101 131 709 188.6 4.6e-50
Q9FR39 Zea m 12.0105 131 707 188.1 6.5e-50
O22655 Zea m 12.0104 131 707 188.1 6.5e-50
Q42449 Ara t 8 131 703 187.1 1.3e-49
AAL76933 Dau c 4 134 703 187.1 1.4e-49
A0A0A0REA1 Koc s 2.0101 133 702 186.8 1.6e-49
A0A0A0RCW1 Aca f 2 133 702 186.8 1.6e-49
P49234 Tri a 12.0103 140 702 186.8 1.8e-49
QVU02258 Que ac 2.0101 133 701 186.6 1.9e-49
P84177 Cit s 2.0101 131 698 185.8 3.2e-49
P35082 Zea m 12.0102 131 697 185.6 3.9e-49
ACS34771 Sal k 4.0101 133 697 185.5 4e-49
Q9XF37 Api g 4 134 697 185.5 4e-49
Q5EF31 Cro s 1.0101 131 695 185.0 5.5e-49
O24169 Ole e 2 134 689 183.5 1.7e-48
XP030492464 Can s 2.0101 133 686 182.7 2.8e-48
O49894 Mer a 1 133 685 182.5 3.4e-48
P25816 Bet v 2 133 683 182.0 4.8e-48
QRN65366 Lig v 2.0101 134 682 181.7 5.8e-48
O24170 Ole e 2 134 680 181.2 8.3e-48
Q9XG85 Par j 3 132 677 180.4 1.4e-47
ADK22841 Sal k 4.0201 133 675 179.9 2e-47
O24171 Ole e 2 134 675 179.9 2e-47
Q9T0M8 Par j 3 131 674 179.6 2.3e-47
AJ421030 Art v 4.0101 133 663 176.8 1.7e-46
AJ421031 Art v 4.0201 133 661 176.3 2.4e-46
O81982 Hel a 2 133 661 176.3 2.4e-46
FG438715 Act d 9.0101 109 652 174.1 8.9e-46
QEQ43417 Sola m 1.0101 159 486 131.2 1.1e-32
A0A1B2YLJ4 Tyr p 36.0101 131 271 76.1 3.5e-16
C0HJX6 Pla l 2.0101 42 95 31.6 0.0027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 237.2 bits 898,  Expect = 1e-64
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLIDTGL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 2. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 208.2 bits 785,  Expect = 6e-56
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+CEIEG+ L+SAAI+GQDG VWAQS+ FPQFKPEEITAIMNDFAEPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGE GA+I GKKGPGG+T++KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 3. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 207.4 bits 782,  Expect = 1e-55
 Identities = 109/131 83%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+C+IEG+HL+SAAI+GQDG VWAQS++FPQFKPEEITAIMNDFAEPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+T++KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDY+I+ GL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 4. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 207.1 bits 781,  Expect = 1e-55
 Identities = 109/130 83%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+CEIEG+HLS+AAI+GQDG VWAQS++FPQFK EEIT IM+DF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGA+I GKKGPGGVT++KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 5. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 206.1 bits 777,  Expect = 2e-55
 Identities = 109/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HLLC+IEG+HL+ AAI+GQDG VWAQS+ FPQFKPEEITAIMNDF EPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKGPGGVT++KT  ALIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTG 130
            R GDYLID G
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 6. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 205.6 bits 775,  Expect = 4e-55
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HLLCE EG+HL+SAAI+GQDG VWAQS++FPQFKPEEIT IMNDFA PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP A+I GKKGPGG+TI+KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 7. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 205.6 bits 775,  Expect = 4e-55
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HLLCE EG+HL+SAAI+GQDG VWAQS++FPQFKPEEIT IMNDFA PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEP A+I GKKGPGG+TI+KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 8. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 205.4 bits 774,  Expect = 4e-55
 Identities = 109/130 83%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HLLC IEG+HL+ AAI+GQDG VW QS+ FPQFKPEEITAIMNDF EPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKGPGGVT++KT  ALIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 9. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 203.3 bits 766,  Expect = 2e-54
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ Y D HL+CEIEG+ L++AAI+G+DG VWAQSS FPQ+KPEEIT +MNDF EPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKGPGGVT++KT+QALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 10. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 202.5 bits 763,  Expect = 3e-54
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD HL+CEIEG+HL+SAAI+GQDG VWAQS +FPQ+KPEE+  I+ DFA+PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGA+I GKKGPGGVT++KT  AL+IGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 11. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 202.5 bits 763,  Expect = 3e-54
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+CE +G HL++AAI+G+DG VWAQS++FPQFKP EI AIM DF EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKGPGG+T++KT QALIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL+D GL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 12. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 201.8 bits 760,  Expect = 5e-54
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTY D HL+CEIEG+ L++AAI+G+DG VWAQSS FPQ+KPEEIT +MNDF EPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGA+I  KKGPGGVT++KT+QALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 13. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 201.8 bits 760,  Expect = 5e-54
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+CEIEG+HLS+AAI+G+DG VWAQS+ FPQ+KPEE+T I+NDF EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKGPGGVT++K+  AL+IGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ GL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 14. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 201.8 bits 760,  Expect = 5e-54
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+CEIEG+HL+SAAI+GQDG VWA+S +FPQ+KPEEIT I+NDF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLY+GG+KYMVIQGEPGA+I GKKGPGGVT++KT  AL+IGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 15. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 201.5 bits 759,  Expect = 6e-54
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+C+IEG+HLSSAAILG+DG VWAQS  FPQ+KPEE++AIM DF EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKGPGGVTI+KTNQALIIGIY +PMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            R+GDYL++ G+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 16. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 201.5 bits 759,  Expect = 6e-54
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD  L+CEIEG+HL++AAI+GQDG VWAQSS+FPQFK EEITAIM+DF EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKGPGGVT+ KTNQALIIGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 17. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 200.5 bits 755,  Expect = 1e-53
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+CEIEG+HLS+AAI+G++G VWAQS+ FPQ+KPEE+T IMNDF EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPG +I GKKGPGGVT++K+  AL+IGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 18. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 198.2 bits 746,  Expect = 6e-53
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+C+I+G HL++AAI+G+DG VWAQSS FPQFKPEE+ AIM DF EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKG GG+T++KT QALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 19. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 198.2 bits 746,  Expect = 6e-53
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD HL+CEI+G HL++AAILG+DG VWAQSS FPQFK EEIT IMNDF EPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLG TKYMVIQGEPGA+I GKKG GGVT++KTNQALI GIY++PMTPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ G+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 20. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 197.6 bits 744,  Expect = 9e-53
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+CEI+G HLSSAAILG+D  VWAQS +FPQFKPEEI+AI+NDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPG +I GKKG GG+T++KTN ALIIG+YD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 21. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 196.6 bits 740,  Expect = 2e-52
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEI+G HL++AAI+G+DG VWAQSS FPQFKPEEI AIM DF EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+T++KT QALI GIYD+P+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ GL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 22. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 195.6 bits 736,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HL+SAAI+G+DG VWAQS+ FPQFKPEE+T IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GG+T++KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ GL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 23. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 195.6 bits 736,  Expect = 4e-52
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HL+SAAILG+DG VWAQS+ FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEPGA+I GKKG GG+TI+KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 24. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 195.3 bits 735,  Expect = 4e-52
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G HL++AAILG+DG VWAQSS FP+FKPEEITAIM DF EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GGVT++KT+QAL+ GIY++P+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 25. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 195.1 bits 734,  Expect = 5e-52
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+IEG+ L+SAAI+G+DG VWA S+ FPQF  EE++AIM DF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKG GGVT++KTNQALIIG+YD+P+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 26. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 194.6 bits 732,  Expect = 8e-52
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HLSSAAI+G+DG VWAQS+ FPQFKPEE+T I+ DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            AP GL+LG TKYMVIQGEPGA+I GKKG GG+T++KT QAL+IGIYD+PMTPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ GL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 27. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 194.0 bits 730,  Expect = 1e-51
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+C+I+G  L++AAI+G+DG VWAQSS FPQFK +E+ A+M DF EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKG GG+T++KT QALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL+D GL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 28. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 193.8 bits 729,  Expect = 1e-51
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HL+SAAILG+DG VWAQS+ FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEPG +I GKKG GG+TI+KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 29. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 193.8 bits 729,  Expect = 1e-51
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HL+SAAILG+DG VWAQS+ FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEPG +I GKKG GG+TI+KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 30. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 193.3 bits 727,  Expect = 2e-51
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HL+SAAI+G+DG  WAQS+ FP+FKPEE+ AIM DF EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL LGGTKYMVIQGEPGA+I GKKG GG+T++KT Q+LIIGIYD+PMTPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 31. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 193.0 bits 726,  Expect = 2e-51
 Identities = 99/131 75%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+C++EG+ L++AAILGQDG VWAQS++FPQ+KPEEI  I NDFAEPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEP A+I GKKG GGVTI+KT QA++ GIY++PMTPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 32. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 192.0 bits 722,  Expect = 4e-51
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HLLC+I+G  L++AAI+G+DG VWAQS  FPQ KPEEI AIM DF EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKG GGVTI+KTN ALIIGIY++PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL D G+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 33. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 192.0 bits 722,  Expect = 5e-51
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HL+CEIEG  +HLS+AAILG DG VWAQS+ FPQFKP+EI+A++ DF  PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGGTKYMVIQGEPG +I GKKGPGG+ ++KT QALIIGIYD+P+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL++ G+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 34. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 191.7 bits 721,  Expect = 5e-51
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP FKPEEI AI+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+T++KTNQALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 191.7 bits 721,  Expect = 5e-51
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+C+I+G  L++AAI+G+DG VWAQSS FPQFK +E+ A+M DF EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKG GG+T++KT QALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 36. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 191.5 bits 720,  Expect = 6e-51
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP FKPEEI AI+ DF +PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+T++KTNQALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 191.5 bits 720,  Expect = 6e-51
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP FKPEEI AI+ DF +PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+T++KTNQALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 191.2 bits 719,  Expect = 8e-51
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSW+ YVD+HL CEI+G HL+SAAILG+DG VWAQS +FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT  ALI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 191.0 bits 718,  Expect = 9e-51
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+ L+C+I+G HL++AAILG+DG VWA+SS FP+FKPEEITAIM DF EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GGVT++KT QAL+ GIY++P+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 40. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 190.7 bits 717,  Expect = 1e-50
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+CEIEG HL+SAAI+G+DG VWAQS+ FPQFKPEEIT IM D+ EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTG+++   KYMVIQGEPGA+I GKKG GG+TI+KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 41. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 190.7 bits 717,  Expect = 1e-50
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+CEIEG HL+SAAI+G+DG VWAQS+ FP FKPEE+  IM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GGVT++KT QAL+IGIYD+PMTPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIDTGL 131
            +LGDYLI+ G+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 42. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 190.7 bits 717,  Expect = 1e-50
 Identities = 97/131 74%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP FKPEEI AI+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPGA+I GKKG GG+TI+KT+QAL+IGIYD+P+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 190.4 bits 716,  Expect = 1e-50
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+C+I+G  L++AAI+G+DG VWAQSS FPQFK +E+ AIM DF EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GG+T++KT+QALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 44. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 189.9 bits 714,  Expect = 2e-50
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP FKPEEI AI+ D+ +PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+T++KTNQALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 45. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 189.9 bits 714,  Expect = 2e-50
 Identities = 98/130 75%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL CEI+G HL+SAAILG+DG VW +S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT  ALI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 46. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 189.9 bits 714,  Expect = 2e-50
 Identities = 98/130 75%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL CEI+G HL+SAAILG+DG VWA+S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT  ALI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 47. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 189.1 bits 711,  Expect = 3e-50
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQ YVD+HL+CEIEG  +HL+ AAILG DG VWAQS+ FPQFKP+EI AI+ DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGGTKYMVIQGEPGA+I GKKG GG+ ++KT QAL++GIYD+P+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDTG 130
            VERLGDYLI+ G
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 48. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 188.6 bits 709,  Expect = 5e-50
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL CEI+G HL+SAAILG+DG VW QS +FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT   LI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 49. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 188.1 bits 707,  Expect = 7e-50
 Identities = 95/131 72%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HLLC+IEG HLS+AAI+G+DG VWAQS +FP++KPEE+  ++ DF EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG +I GKKG GG+TI+KT  +LIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ G+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 50. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 188.1 bits 707,  Expect = 7e-50
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD HL+CEIEG HLS+AAI+G+DG VWAQS  FP++KPEE+  I+ DF EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG +I GKKG GG+TI+KT  +LIIG+YD+PMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ G+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 51. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 187.1 bits 703,  Expect = 1e-49
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ+YVD+HL+C++EG+HL++AAILGQDG VWAQS+ FPQ+KP+EI  I  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGG KYMVIQGE GA+I GKKGPGGVTI+KTNQAL+ G YD+PMT GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI++ L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 52. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 187.1 bits 703,  Expect = 1e-49
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDNHLLCEIEGD---HLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
            MSWQTYVD+HL+CE++G+   +LS+AAI+G+DG VWAQSS FP+FKPEEIT IM +F EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP A+I GKKG GGVTI+KT QAL+ G+YD+P+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLIDTGL 131
            IVERLGDYLI+ GL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 53. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 186.8 bits 702,  Expect = 2e-49
 Identities = 97/131 74%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HL+C+IEG  +HL+ AAILG DG VWAQS++FPQFKP+EI AI+ +F EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGGTKYMVIQGE G +I GKKGPGG+ ++KT QALI GIYD+P+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL++ G+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 54. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 186.8 bits 702,  Expect = 2e-49
 Identities = 97/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            M WQTYVD+HL+CEIEG  +HLS AAILG DG VWAQS+ FPQFKP+EI A++ DF  PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGGTKYMVIQGEPG  I GKKGPGG+ ++KT QAL+ GIYD+P+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL++ G+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 186.8 bits 702,  Expect = 2e-49
 Identities = 97/130 74%, Positives = 113/130 86%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSW+ YVD+HL CEI+G +L+SAAILG+DG VWAQS +FPQFKPEE   I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT  ALI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 56. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 186.6 bits 701,  Expect = 2e-49
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEGD--HLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD HL+C+I+G   HL++AAI+G+DG VWAQSS+FPQFK EEI+ IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
             LAPTGL+LGGTKYMVIQGE GA+I GKKG GGVTI+KT+QAL+ GIY++P+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL+D GL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 57. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 185.8 bits 698,  Expect = 3e-49
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD+HL+C+I+G+ L++AAILGQDG VW+QS+ FP F+ EEI AI+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LGGTKYMVIQGE GA+I GKKG GG+ ++KTNQALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 58. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 185.6 bits 697,  Expect = 4e-49
 Identities = 93/131 70%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQ YVD HL+CEIEG HL++AAI+G+DG  WAQS+ FP+FK E++  IM DF EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GG+T++KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDTGL 131
            RLGDYL++ G+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 59. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 185.5 bits 697,  Expect = 4e-49
 Identities = 96/131 73%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HL+CEIEG  +HL++AAILG DG VWAQS++FPQFKP+EI+A++ +F E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGGTKYMVIQGE G +I GKKGPGG+ ++KT QALI GIYD+P+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL++ G+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 60. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 185.5 bits 697,  Expect = 4e-49
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 3/131 2%
Query  1    MSWQTYVDNHLLCEIEGDH---LSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
            MSWQ YVD+HL+CE+EG+    L++AAI+G+DG VWAQSS FPQ KPEEI  IM DF EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP A+I GKKG GGVTI+KT QAL+ G+YD+P+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLIDTGL 131
            IVERLGDYLID GL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 61. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 185.0 bits 695,  Expect = 6e-49
 Identities = 95/130 73%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD HL+C+++G  L+SAAILG+DG VWAQS+ FP++KP EITAI+NDF EPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
            APTG+Y+ G KYMVIQGEPG +I GKKG GGVTI+K+N ALI G+YD+PMTPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDTG 130
            RLGDYLI+ G
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 62. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 183.5 bits 689,  Expect = 2e-48
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDNHLLCEIEG--DH-LSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
            MSWQ YVD+HL+C+IEG  DH L++AAI+G+DG VWAQS+ FPQFKPEE+  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDTGL 131
            +VERLGDYL++ G+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 63. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 182.7 bits 686,  Expect = 3e-48
 Identities = 97/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEGD--HLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD HL+C+I+G   HL++AAI+G+DG +WAQSS FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
             LAPTGL+L GTKYMVIQGEPGA+I GKKG GGVTI+KT QALI GIY++P+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL+D GL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 64. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 182.5 bits 685,  Expect = 3e-48
 Identities = 94/131 71%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEGD--HLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HL+C+I+G   HL++A+I+G+DG +WAQS+ FPQ+KPEEIT IM DF EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
             LAPTGLY+ GTKYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYLI+ G+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 65. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 182.0 bits 683,  Expect = 5e-48
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEGDHLSS--AAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD HL+C+I+G   +S  +AI+G+DG VWAQSS FPQFKP+EIT IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
             LAPTGL+LGG KYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM+
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYLID GL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 66. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 181.7 bits 682,  Expect = 6e-48
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDNHLLCEIEG--DH-LSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
            MSWQ YVD+HL+C+IEG  DH L++AAI+G+DG VWAQS+ FPQFKPEEI  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
            G+LAPTGL+LGGTKYMVIQGE GA+I GKKG GG+TI+KTNQAL+ GIY++P+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDTGL 131
            +V RLGD L+  G+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 67. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 181.2 bits 680,  Expect = 8e-48
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQTYVDNHLLCEIEGDH---LSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
            MSWQ YVD+HL+C+IEG     L++AAI+G+DG VWAQS+ FPQFKPEE+  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDTGL 131
            +VERLGDYL++ GL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 68. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 180.4 bits 677,  Expect = 1e-47
 Identities = 93/131 70%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQTYVDNHLLCEI-EGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGS 59
            MSWQ YVD+HL+C++ +G+  +SAAI+G+DG VWAQS++FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIV 119
            LAPTGL+LGGTKYMVIQGE GA+I GKKG GG T++KT QA++IGIYD+PMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIDTGL 131
            ERLGDYL++ GL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 69. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 179.9 bits 675,  Expect = 2e-47
 Identities = 95/131 72%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIE--GDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQ YVD HL+C IE  G+HL+S+AI+G DG +WAQSS+FPQ KP+EI AI  +F  P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGG KYMVIQGEPGA+I GKKGPGGV I+KT QALI GIYD+P+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYLI+ GL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 70. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 179.9 bits 675,  Expect = 2e-47
 Identities = 94/131 71%, Positives = 114/131 87%, Gaps = 3/131 2%
Query  1    MSWQTYVDNHLLCEIEGDH---LSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
            MSWQ YVD+HL+C+IEG     L++AAI+G+DG VWAQS+ FPQFKPEE+  IM DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GA+I GKKG GG+TI+KT QAL+ GIY++P+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDTGL 131
            + ERLGDYL++ GL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 71. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 179.6 bits 674,  Expect = 2e-47
 Identities = 93/130 71%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDNHLLCEI-EGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGS 59
            MSWQ YVD+HL+C++ +G+ L+SAAI+G+DG VWAQS++FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIV 119
            LAPTGL+LGGTKYMVIQGE GA+I GKKG GG T++KT QA++IGIYD+PMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIDTGL 131
            ERLGDYL++ G+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 176.8 bits 663,  Expect = 2e-46
 Identities = 91/131 69%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HL+C+IEG   HL+SAAI+G DG VWA+S+ FP+FKP EI AI+ +F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
             LAPTGL+LGG KYMVIQGE GA+I GKKG GG+ I+KT QA++ GIYD+P+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL+D G+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 176.3 bits 661,  Expect = 2e-46
 Identities = 90/131 68%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQTYVD+HL+C+IEG   HL++AAILG DG VWA+S  FP+FKPEE+  I+N+F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTGL+LGG KYMV+QGE GA+I GKKG GG+ I+KT QA+++GIYD+P+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL+D  +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 176.3 bits 661,  Expect = 2e-46
 Identities = 89/131 67%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
            MSWQ YVD HL+C+IEG   HL+SAAILG DG VWAQS+ FPQFKPEE+  I+ +F E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
            +LAPTG+++ G KYMV+QGEPGA+I GKKG GG+ I+KT QA+I+GIYD+P+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDTGL 131
            VERLGDYL++ G+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 174.1 bits 652,  Expect = 9e-46
 Identities = 91/109 83%, Positives = 105/109 96%, Gaps = 0/109 0%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
            MSWQTYVD+HL+CEIEG++L+SAAI+GQDG +WAQS+ FPQFKPEEITAIMNDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKP 109
            APTGLYLGGTKYMVIQGE GA+I GKKGPGGVT++KTNQALIIGIYD+P
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 131.2 bits 486,  Expect = 1e-32
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 28/130 21%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQ------------------- 41
            MSWQTYVD+HL+C++EG HL+SAAILG DG VWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGV 92
                     FKPEEIT IM DF EPG LAPTGL+LGGTKYMVIQGEPGA+I GKKG  G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIEKTNQALIIGIYDKPMTPGQCNMIVERLGDYLIDTG 130
            TI+KT QALI GIY++P+TPGQCNM+VE++GDYL+D G
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 76.1 bits 271,  Expect = 4e-16
 Identities = 50/123 40%, Positives = 74/123 60%, Gaps = 6/123 4%
Query  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQ-SSHFP-QFKPEEITAIMNDF-AEP 57
            MSWQ+YVDN++ C+     L+  A L QDG VWA+    +P Q   +E+  I +   + P
Sbjct  1    MSWQSYVDNQI-CQHVDCRLAVIAGL-QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
             S+   G++LGG KY+ IQ +  +++ G+KG   + I  TN  L+         PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  IVERLGDYL 126
            +VE+LGDYL
Sbjct  118  VVEKLGDYL 126

Sequence Alignment: 78. Allergen Name: Pla l 2.0101 Sequence ID: C0HJX6

 Score = 31.6 bits 95,  Expect = 0.003
 Identities = 26/31 83%, Positives = 28/31 90%, Gaps = 29/31 93%
Query  24   AILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAII 83
            AILGQDG VWAQ                            GL+LGG KY VI GEPGA+I
Sbjct  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.