The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL
APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE
RLGDYLIDQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAP13533 Cuc m 2 131 895 236.5 1.8e-64
Q5XWE1 Citr l 2.0101 131 825 218.5 4.7e-59
Q9STB6 Hev b 8.0102 131 804 213.1 2e-57
CAD37202 Pru p 4.0201 131 795 210.8 9.7e-57
O22655 Zea m 12.0104 131 789 209.3 2.8e-56
Q9AXH4 Cor a 2 131 789 209.3 2.8e-56
Q9XF41 Mal d 4 131 788 209.0 3.4e-56
CAD10377 Lyc e 1 131 787 208.7 4.1e-56
Q93YG7 Sola l 1.0101 131 787 208.7 4.1e-56
O65809 Gly m 3 131 787 208.7 4.1e-56
O65810 Gly m 3 131 784 208.0 6.9e-56
Q9FR39 Zea m 12.0105 131 781 207.2 1.2e-55
AAL29690 Lyc e 1 131 781 207.2 1.2e-55
CAD10376 Cap a 2 131 780 206.9 1.4e-55
AAK01235 Cor a 2 131 778 206.4 2e-55
AAL07320 Lit c 1 131 771 204.6 7e-55
FM164277 Tri a 12.0104 131 771 204.6 7e-55
Q9M7N0 Hev b 8.0201 131 767 203.6 1.4e-54
P49233 Tri a 12.0102 141 766 203.3 1.9e-54
O65812 Hev b 8.0101 131 765 203.1 2e-54
ABU95412 Sin a 4.0101 131 764 202.8 2.4e-54
Q9SQI9 Ara h 5 131 763 202.6 2.9e-54
P49232 Tri a 12.0101 138 761 202.0 4.5e-54
O24650 Phl p 12.0102 131 759 201.6 5.9e-54
Q9FUD1 Ory s 12.0101 131 758 201.3 7.1e-54
AAL92870 Che a 2 131 757 201.0 8.5e-54
A0A2I4DNN6 Jug r 7.0101 131 757 201.0 8.5e-54
P49234 Tri a 12.0103 140 755 200.5 1.3e-53
P35083 Zea m 12.0103 131 752 199.8 2.1e-53
CAA54686 Phl p 12.0101 131 752 199.8 2.1e-53
AAK54835 Ana c 1 131 752 199.8 2.1e-53
P35079 Phl p 12.0101 131 752 199.8 2.1e-53
P52184 Hor v 12.0101 131 751 199.5 2.5e-53
O04725 Cyn d 12 131 748 198.7 4.2e-53
ACP43298 Ama r 2.0101 133 747 198.5 5.1e-53
Q9LEI8 Hev b 8.0204 131 745 198.0 7.2e-53
P35081 Zea m 12.0101 131 745 198.0 7.2e-53
A0A023W2L7 Pro j 2.0101 133 745 197.9 7.3e-53
QID21357 Pop n 2.0101 131 744 197.7 8.6e-53
O24282 Phl p 12.0103 131 742 197.2 1.2e-52
Q9XF37 Api g 4 134 742 197.2 1.3e-52
Q8L5D8 Pho d 2.0101 131 740 196.7 1.7e-52
AF377948 Mus a 1.0101 131 738 196.2 2.5e-52
Q9M7M8 Hev b 8.0203 131 736 195.6 3.6e-52
CAD37201 Pru p 4.0101 131 736 195.6 3.6e-52
Q9XF42 Mal d 4 131 736 195.6 3.6e-52
A0A0A0REA1 Koc s 2.0101 133 735 195.4 4.4e-52
AY081850 Pru du 4.0101 131 733 194.9 6.1e-52
AY081852 Pru du 4.0102 131 733 194.9 6.1e-52
A0A0A0RCW1 Aca f 2 133 731 194.3 8.9e-52
Q9XF38 Pyr c 4 131 730 194.1 1e-51
Q9XF39 Pru av 4 131 729 193.8 1.2e-51
P35082 Zea m 12.0102 131 724 192.6 3e-51
ACS34771 Sal k 4.0101 133 724 192.6 3.1e-51
Q9M7M9 Hev b 8.0202 131 722 192.0 4.3e-51
Q9XF40 Mal d 4 131 722 192.0 4.3e-51
AAL76933 Dau c 4 134 718 191.0 9.1e-51
Q42449 Ara t 8 131 717 190.8 1e-50
O49894 Mer a 1 133 717 190.8 1.1e-50
XP030492464 Can s 2.0101 133 717 190.8 1.1e-50
Q9XG85 Par j 3 132 716 190.5 1.3e-50
ADK22841 Sal k 4.0201 133 715 190.2 1.5e-50
Q5EF31 Cro s 1.0101 131 714 190.0 1.8e-50
P84177 Cit s 2.0101 131 713 189.7 2.1e-50
QVU02258 Que ac 2.0101 133 711 189.2 3.1e-50
O24169 Ole e 2 134 711 189.2 3.2e-50
O24170 Ole e 2 134 710 188.9 3.8e-50
O24171 Ole e 2 134 705 187.7 9.2e-50
Q9T0M8 Par j 3 131 703 187.2 1.3e-49
O81982 Hel a 2 133 703 187.2 1.3e-49
P25816 Bet v 2 133 702 186.9 1.6e-49
QRN65366 Lig v 2.0101 134 693 184.6 7.8e-49
AJ421031 Art v 4.0201 133 685 182.5 3.2e-48
AJ421030 Art v 4.0101 133 676 180.2 1.6e-47
FG438715 Act d 9.0101 109 639 170.9 8.5e-45
QEQ43417 Sola m 1.0101 159 488 131.8 7.2e-33
A0A1B2YLJ4 Tyr p 36.0101 131 263 74.1 1.3e-15
C0HJX6 Pla l 2.0101 42 88 30.1 0.008
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 236.5 bits 895,  Expect = 2e-64
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 2. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 218.5 bits 825,  Expect = 5e-59
 Identities = 117/131 89%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEGNHLTSAAIIGQDGSVWA+S+NFPQLKPEE+ GI+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLYIGG+KYMVIQGEPGAVIRGKKGPGGVTVKKT +ALVIGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 213.1 bits 804,  Expect = 2e-57
 Identities = 114/130 87%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEGNHL++AAIIGQDGSVWAQS NFPQ+K EE+ GI+ DF +PGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 4. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 210.8 bits 795,  Expect = 1e-56
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEGNHL++AAIIG+DGSVWAQS  FPQLKPEEV GI+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKK+ +AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 5. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 209.3 bits 789,  Expect = 3e-56
 Identities = 106/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG HL++AAI+G+DGSVWAQS++FP+LKPEEVAGI+ DF +PGTL
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGM+L+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 6. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 209.3 bits 789,  Expect = 3e-56
 Identities = 111/131 84%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ Y DEHLMCEIEGN L +AAIIG+DGSVWAQS  FPQLKPEE+ G++ DF +PG+L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 7. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 209.0 bits 788,  Expect = 3e-56
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEGNHL++AAIIG++GSVWAQS  FPQLKPEEV GI+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPG VIRGKKGPGGVTVKK+ MAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 8. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 208.7 bits 787,  Expect = 4e-56
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHL+CE EGNHLTSAAIIGQDG+VWAQS NFPQ+KPEE+ GI+ DFA PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEP AVIRGKKGPGG+T+KKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 9. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 208.7 bits 787,  Expect = 4e-56
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHL+CE EGNHLTSAAIIGQDG+VWAQS NFPQ+KPEE+ GI+ DFA PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEP AVIRGKKGPGG+T+KKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 10. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 208.7 bits 787,  Expect = 4e-56
 Identities = 109/130 83%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL+C+IEGNHLT AAIIGQDGSVWAQS +FPQ+KPEE+  I+ DF +PG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTG AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            R GDYLIDQG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 11. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 208.0 bits 784,  Expect = 7e-56
 Identities = 109/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL+C IEGNHLT AAIIGQDGSVW QS +FPQ+KPEE+  I+ DF +PG+L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTG AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 12. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 207.2 bits 781,  Expect = 1e-55
 Identities = 104/131 79%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL+C+IEG HL++AAI+G+DGSVWAQS+NFP+LKPEEVAG++ DF +PGTL
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGM+L+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 13. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 207.2 bits 781,  Expect = 1e-55
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+IEGNHLTSAAIIGQDGSVWAQS NFPQ+KPEE+  I+ DFA+PGTL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+TVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDY+I+QGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 14. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 206.9 bits 780,  Expect = 1e-55
 Identities = 111/131 84%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEGN LTSAAIIGQDGSVWAQS  FPQ+KPEE+  I+ DFA+PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGE GAVIRGKKGPGG+TVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+Q L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 15. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 206.4 bits 778,  Expect = 2e-55
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ Y DEHLMCEIEGN L +AAIIG+DGSVWAQS  FPQLKPEE+ G++ DF +PG+L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGAVIR KKGPGGVTVKKT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 16. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 204.6 bits 771,  Expect = 7e-55
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCE +G HLT+AAIIG+DGSVWAQS NFPQ+KP E+A I+ DF +PG+L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKGPGG+TVKKT  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 17. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 204.6 bits 771,  Expect = 7e-55
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSW+ YVD+HL CEI+G HLTSAAI+G+DGSVWAQS NFPQ+KPEE+AGIV DF +PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGMAL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 18. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 203.6 bits 767,  Expect = 1e-54
 Identities = 106/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMC+I+G+HLT+AAIIG+DGSVWAQS +FPQ+KPEEVA I+ DF +PG+L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 19. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 203.3 bits 766,  Expect = 2e-54
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL CEI+G HLTSAAI+G+DGSVWA+S NFP++KPEE+AGIV DF +PG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGMAL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 20. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 203.1 bits 765,  Expect = 2e-54
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDE LMCEIEGNHLT+AAIIGQDGSVWAQS NFPQ+K EE+  I+ DF +PGTL
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKGPGGVTV+KT  AL+IGIYDEPMTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 21. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 202.8 bits 764,  Expect = 2e-54
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC++EGN LT+AAI+GQDGSVWAQS NFPQLKPEE+ GI  DFA+PGTL
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL+IGGTKYMVIQGEP AVIRGKKG GGVT+KKT  A+V GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 22. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 202.6 bits 763,  Expect = 3e-54
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD HL+CEIEG+HL+SAAI+GQDG VWAQS +FPQ+KPEE+  I+ DFA+PG+L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGA+I GKKGPGGVT++KT  AL+IGIYD+PMTPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLID GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 23. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 202.0 bits 761,  Expect = 4e-54
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL CEI+G HLTSAAI+G+DGSVW +S NFP++KPEE+AGIV DF +PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGMAL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 24. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 201.6 bits 759,  Expect = 6e-54
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HL SAAI+G+DG+VWAQS +FPQ+KPEE+ GI+ DF +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 25. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 201.3 bits 758,  Expect = 7e-54
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HLTSAAI+G+DG+VWAQS  FPQ+KPEE+  I+ DF +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 26. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 201.0 bits 757,  Expect = 8e-54
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+IEGNHL+SAAI+G+DG+VWAQS +FPQLKPEEV+ I+ DF +PG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKGPGGVT+KKT  AL+IGIY EPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            R+GDYL++QG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 27. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 201.0 bits 757,  Expect = 8e-54
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEI+G HLT+AAIIG+DGSVWAQS +FPQ+KPEE+A I+ DF +PG+L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+TVKKTG AL+ GIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 28. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 200.5 bits 755,  Expect = 1e-53
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSW+ YVD+HL CEI+G +LTSAAI+G+DGSVWAQS NFPQ+KPEE AGIV DF +PG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGMAL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 199.8 bits 752,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HL+SAAI+G+DG+VWAQS  FPQ+KPEE+  I+ DF +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            AP GL++G TKYMVIQGEPGAVIRGKKG GG+TVKKTG ALVIGIYDEPMTPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 30. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 199.8 bits 752,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HL SAAI+G+DG+VWAQS +FPQ+KPEE+ GI+ DF +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 31. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 199.8 bits 752,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEI+G HL+SAAI+G+D +VWAQS NFPQ+KPEE++ I+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPG VIRGKKG GG+TVKKT +AL+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 32. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 199.8 bits 752,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HL SAAI+G+DG+VWAQS +FPQ+KPEE+ GI+ DF +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 33. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 199.5 bits 751,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL CEI+G HLTSAAI+G+DG VW QS NFPQ+KPEE+AGI+ DF +PG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGM L++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 34. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 198.7 bits 748,  Expect = 4e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEG+HLTSAAIIG+DG+VWAQS  FP +KPEE+A I+ DF +PG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GGVTVKKTG ALVIGIYDEPMTPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIDQGL 131
            +LGDYLI+QG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 35. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 198.5 bits 747,  Expect = 5e-53
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMCEIEG  NHLT AAI+G DGSVWAQS +FPQ+KP+E+A IV DF +PG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GGTKYMVIQGEPGAVIRGKKG GG+ VKKTG ALV+GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 36. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 198.0 bits 745,  Expect = 7e-53
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAIIG+DGSVWAQS +FPQ+K +EVA ++ DF +PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL+DQGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 37. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 198.0 bits 745,  Expect = 7e-53
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HLTSAAI+G+DG+ WAQS  FP++KPEE+A I+ DF +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL +GGTKYMVIQGEPGAVIRGKKG GG+TVKKTG +L+IGIYDEPMTPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 38. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 197.9 bits 745,  Expect = 7e-53
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMCEIEG  NHL++AAI+G DGSVWAQS +FPQ+KP+E++ +V DF  PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GGTKYMVIQGEPG VIRGKKGPGG+ VKKTG AL+IGIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 39. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 197.7 bits 744,  Expect = 9e-53
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQVYVD+HLMC+IEGN LTSAAIIG+DGSVWA S +FPQ+  EEV+ I+ DF +PG+L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GGVTVKKT  AL+IG+YDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 40. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 197.2 bits 742,  Expect = 1e-52
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HL SAAI G+DG+VWAQS +FPQ+KPEE+ GI+ D+ +PG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTG+++   KYMVIQGEPGAVIRGKKG GG+T+KKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 41. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 197.2 bits 742,  Expect = 1e-52
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQVYVDEHLMCEIEGNH---LTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVD+HLMCE+EGN    LT+AAIIG+DGSVWAQS  FPQ+KPEE+AGI+ DF +P
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            G LAPTGLY+GG KYMVIQGEP AVIRGKKG GGVT+KKTG ALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLIDQGL 131
            IVERLGDYLIDQGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 42. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 196.7 bits 740,  Expect = 2e-52
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEI+G+HLT+AAI+G+DGSVWAQS +FPQ+K EE+  I+ DF +PG+L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+G TKYMVIQGEPGAVIRGKKG GGVTVKKT  AL+ GIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 43. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 196.2 bits 738,  Expect = 2e-52
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HL+C+I+G  LT+AAI+G+DGSVWAQS  FPQ KPEE+A I+ DF +PG+L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKG GGVT+KKT +AL+IGIY+EPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL DQG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 44. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 195.6 bits 736,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAIIG+DGSVWAQS  FPQ+K +EVA ++ DF +PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 45. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 195.6 bits 736,  Expect = 4e-52
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS  FP +KPEE+A I+ DF  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+TVKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 195.6 bits 736,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS +FP +KPEE+A I+ DF  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGEPGAVIRGKKG GG+T+KKT  AL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 47. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 195.4 bits 735,  Expect = 4e-52
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMC+IEG  NHLT AAI+G DGSVWAQS NFPQ+KP+E+A IV +F +PG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GGTKYMVIQGE G VIRGKKGPGG+ VKKTG AL+ GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 48. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 194.9 bits 733,  Expect = 6e-52
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS  FP +KPEE+A I+ DF  PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+TVKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 49. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 194.9 bits 733,  Expect = 6e-52
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS  FP +KPEE+A I+ DF  PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+TVKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 50. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 194.3 bits 731,  Expect = 9e-52
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            M WQ YVD+HLMCEIEG  NHL+ AAI+G DGSVWAQS +FPQ+KP+E+A +V DF  PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GGTKYMVIQGEPG  IRGKKGPGG+ VKKTG ALV GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 51. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 194.1 bits 730,  Expect = 1e-51
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+G+HLT+AAI+G+DGSVWAQS  FP++KPEE+  I+ DF +PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GGVTVKKT  ALV GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 52. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 193.8 bits 729,  Expect = 1e-51
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS  FP +KPEE+A I+ D+  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+TVKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 192.6 bits 724,  Expect = 3e-51
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMCEIEG+HL +AAI+G+DG+ WAQS  FP++K E++A I+ DF +PG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 54. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 192.6 bits 724,  Expect = 3e-51
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMCEIEG  NHLT+AAI+G DGSVWAQS NFPQ+KP+E++ +V +F + G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GGTKYMVIQGE G VIRGKKGPGG+ VKKTG AL+ GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 192.0 bits 722,  Expect = 4e-51
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+G+ LT+AAIIG+DGSVWAQS +FPQ+K +EVA I+ DF +PG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 56. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 192.0 bits 722,  Expect = 4e-51
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+ LMC+I+G+HLT+AAI+G+DGSVWA+S  FP++KPEE+  I+ DF +PG+L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GGVTVKKTG ALV GIY+EP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLIDQGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 57. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 191.0 bits 718,  Expect = 9e-51
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQVYVDEHLMCEIEGN---HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVD+HLMCE++GN   +L++AAIIG+DGSVWAQS  FP++KPEE+ GI+ +F +P
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            G LAPTGLY+GGTKYMVIQGEP AVIRGKKG GGVT+KKTG ALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLIDQGL 131
            IVERLGDYLI+QGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 58. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 190.8 bits 717,  Expect = 1e-50
 Identities = 100/131 76%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC++EGNHLT+AAI+GQDGSVWAQS  FPQLKP+E+ GI  DF +PG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GG KYMVIQGE GAVIRGKKGPGGVT+KKT  ALV G YDEPMT GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 59. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 190.8 bits 717,  Expect = 1e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMC+I+G   HL +A+I+G+DGS+WAQS +FPQLKPEE+ GI+ DF +PG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
             LAPTGLYI GTKYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYLI+QG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 60. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 190.8 bits 717,  Expect = 1e-50
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVDEHLMC+I+G   HLT+AAIIG+DGS+WAQS +FPQLK +E+  I  DF +PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
             LAPTGL++ GTKYMVIQGEPGAVIRGKKG GGVT+KKTG AL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 61. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 190.5 bits 716,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQVYVDEHLMCEI-EGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGT 59
            MSWQ YVD+HLMC++ +GN   SAAIIG+DGSVWAQS NFPQLKPEEV GI+ DF + G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIV 119
            LAPTGL++GGTKYMVIQGE GAVIRGKKG GG T+KKTG A+VIGIYDEPMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIDQGL 131
            ERLGDYL++QGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 62. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 190.2 bits 715,  Expect = 2e-50
 Identities = 100/131 76%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIE--GNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVDEHLMC IE  GNHLTS+AI+G DGS+WAQS NFPQ+KP+E+  I  +F  P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GG KYMVIQGEPGAVIRGKKGPGGV +KKT  AL+ GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYLI+QGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 63. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 190.0 bits 714,  Expect = 2e-50
 Identities = 96/130 73%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVDEHLMC+++G+ LTSAAI+G+DGSVWAQS  FP+LKP E+  I+ DF +PG+L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTG+YI G KYMVIQGEPG VIRGKKG GGVT+KK+ MAL+ G+YDEPMTPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 64. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 189.7 bits 713,  Expect = 2e-50
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMC+I+GN LT+AAI+GQDGSVW+QS  FP ++ EE+A I+ DF  PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
            APTGL++GGTKYMVIQGE GAVIRGKKG GG+ VKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 65. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 189.2 bits 711,  Expect = 3e-50
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVDEHLMC+I+G   HL +AAIIG+DGSVWAQS NFPQ+K EE++ I+ DF +PG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
             LAPTGL++GGTKYMVIQGE GAVIRGKKG GGVT+KKT  ALV GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 66. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 189.2 bits 711,  Expect = 3e-50
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQVYVDEHLMCEIEG--NH-LTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVD+HLMC+IEG  +H LT+AAI+G+DGSVWAQS  FPQ+KPEE+ GI+ DF +P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            G LAPTGL++GGTKYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            +VERLGDYL++QG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 67. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 188.9 bits 710,  Expect = 4e-50
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQVYVDEHLMCEIEGNH---LTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVD+HLMC+IEG+    LT+AAI+G+DGSVWAQS  FPQ+KPEE+ GI+ DF +P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            G LAPTGL++GGTKYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            +VERLGDYL++QGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 68. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 187.7 bits 705,  Expect = 9e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQVYVDEHLMCEIEGNH---LTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVD+HLMC+IEG+    LT+AAI+G+DGSVWAQS  FPQ+KPEE+ GI+ DF +P
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            G LAPTGL++GGTKYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            + ERLGDYL++QGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 69. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 187.2 bits 703,  Expect = 1e-49
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQVYVDEHLMCEI-EGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGT 59
            MSWQ YVD+HLMC++ +GN L SAAIIG+DGSVWAQS NFPQLKPEEV GI+ DF + G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIV 119
            LAPTGL++GGTKYMVIQGE GAVI GKKG GG T+KKTG A+VIGIYDEPMTPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIDQGL 131
            ERLGDYL++QG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 187.2 bits 703,  Expect = 1e-49
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVDEHLMC+IEG   HLTSAAI+G DG+VWAQS  FPQ+KPEE+ GI+ +F + G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTG++I G KYMV+QGEPGAVIRGKKG GG+ +KKTG A+++GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 71. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 186.9 bits 702,  Expect = 2e-49
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 4/130 3%
Query  1    MSWQVYVDEHLMCEIEG---NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVDEHLMC+I+G   N L SA I+G+DGSVWAQS +FPQ+KP+E+ GI+ DF +P
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            G LAPTGL++GG KYMVIQGE GAVIRGKKG GG+T+KKTG ALV GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  IVERLGDYLIDQGL 131
            +VERLGDYLIDQGL
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 72. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 184.6 bits 693,  Expect = 8e-49
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQVYVDEHLMCEIEG--NH-LTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
            MSWQ YVD+HLMC+IEG  +H LT+AAI+G+DGSVWAQS  FPQ+KPEE+ GI+ DF +P
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
            GTLAPTGL++GGTKYMVIQGE GAVIRGKKG GG+T+KKT  ALV GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLIDQGL 131
            +V RLGD L+ QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 182.5 bits 685,  Expect = 3e-48
 Identities = 93/131 70%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMC+IEG   HLT+AAI+G DG+VWA+S  FP++KPEE+ GI+ +F + G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
            TLAPTGL++GG KYMV+QGE GAVIRGKKG GG+ +KKTG A+V+GIYDEP+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQ +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 180.2 bits 676,  Expect = 2e-47
 Identities = 92/131 70%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
            MSWQ YVD+HLMC+IEG   HLTSAAI G DG+VWA+S +FP++KP E+  I+ +F + G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
             LAPTGL++GG KYMVIQGE GAVIRGKKG GG+ +KKTG A+V GIYDEP+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQGL 131
            VERLGDYL+DQG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 170.9 bits 639,  Expect = 9e-45
 Identities = 90/109 82%, Positives = 101/109 92%, Gaps = 0/109 0%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
            MSWQ YVD+HLMCEIEGN+LTSAAIIGQDGS+WAQS +FPQ+KPEE+  I+ DF++PGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEP 109
            APTGLY+GGTKYMVIQGE GAVIRGKKGPGGVTVKKT  AL+IGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 131.8 bits 488,  Expect = 7e-33
 Identities = 95/130 73%, Positives = 116/130 89%, Gaps = 28/130 21%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQ------------------- 41
            MSWQ YVD+HLMC++EG+HL SAAI+G DGSVWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------LKPEEVAGIVGDFADPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGV 92
                     +KPEE+  I+ DF +PG LAPTGL++GGTKYMVIQGEPGAVIRGKKG  G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGMALVIGIYDEPMTPGQCNMIVERLGDYLIDQG 130
            T+KKTG AL+ GIY+EP+TPGQCNM+VE++GDYL+DQG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.1 bits 263,  Expect = 1e-15
 Identities = 47/122 38%, Positives = 77/122 63%, Gaps = 8/122 6%
Query  1    MSWQVYVDEHLMCEIEGNHLTSAAIIG-QDGSVWAQ-SQNFP-QLKPEEVAGIVGDF-AD 56
            MSWQ YVD ++ C+     L  A I G QDG+VWA+  +++P Q+  +E+  I     ++
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCN 116
            P ++   G+++GG KY+ IQ +  +++RG+KG   + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MIVERLGDYL 126
             +VE+LGDYL
Sbjct  117  NVVEKLGDYL 126

Sequence Alignment: 78. Allergen Name: Pla l 2.0101 Sequence ID: C0HJX6

 Score = 30.1 bits 88,  Expect = 0.008
 Identities = 27/32 84%, Positives = 30/32 93%, Gaps = 29/32 90%
Query  24   AIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTLAPTGLYIGGTKYMVIQGEPGAVI 83
            AI+GQDGSVWAQ                            GL++GG KY VI GEPGAVI
Sbjct  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
Query  84   R 84
            R
Sbjct  32   R 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.