The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG
SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI
VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP
DAVYTSNVQFY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q07154 Zea m 1 191 1341 281.2 1.4e-77
P58738 Zea m 1 269 1325 277.8 2e-76
ACA23876 Pas n 1.0101 265 1126 237.4 2.9e-64
AAF72990 Ory s 1 269 1022 216.3 6.6e-58
AAF72991 Ory s 1 267 897 190.9 2.8e-50
AAF72983 Ory s 1 267 895 190.5 3.8e-50
A0A4D6G2J8 Uro m 1.0201 229 892 189.9 4.7e-50
O04701 Cyn d 1 246 889 189.3 7.9e-50
QCX36431 Zoy m 1.0101 272 889 189.3 9e-50
AAL14079 Cyn d 1.0203 262 887 188.9 1.1e-49
A0A4D6FZ45 Uro m 1.0101 262 887 188.9 1.1e-49
AAL14078 Cyn d 1 262 882 187.9 2.3e-49
AAL14077 Cyn d 1.0202 262 879 187.3 3.5e-49
AAF80379 Cyn d 1.0204 244 874 186.3 6.4e-49
AAF72984 Ory s 1 268 873 186.0 8.3e-49
AAK96255 Cyn d 1.0201 244 869 185.3 1.3e-48
AAF72987 Ory s 1 275 860 183.4 5.4e-48
AAF72985 Ory s 1 286 841 179.5 8.2e-47
CAA81613 Phl p 1.0101 263 837 178.7 1.3e-46
AAB61710 Ory s 1 261 828 176.9 4.5e-46
CAA93121 Hol l 1.0102 248 823 175.9 8.6e-46
P43213 Phl p 1 263 823 175.9 9.3e-46
P43216 Hol l 1 265 822 175.7 1.1e-45
AAD10496 Tri a ps93 271 818 174.9 1.9e-45
CAA10140 Hol l 1 263 809 173.0 6.6e-45
CAA10520 Poa p a 263 807 172.6 8.8e-45
CAB63699 Lol p 1.0103 263 806 172.4 1e-44
Q41260 Pha a 1 269 802 171.6 1.8e-44
AAA63278 Lol p 1.0102 252 795 170.2 4.5e-44
AAA63279 Lol p 1.0101 263 786 168.4 1.7e-43
Q40638 Ory s 1 263 785 168.2 1.9e-43
P14946 Lol p 1 263 784 168.0 2.2e-43
AAF72989 Ory s 1 271 782 167.5 3.1e-43
ABC58726 Sor h 1.0101 239 753 161.7 1.5e-41
AAA50175 Gly m 2 277 627 136.1 9.4e-34
AAF72986 Ory s 1 275 594 129.4 9.7e-32
AAF72988 Ory s 1 327 578 126.1 1.1e-30
CAB37496 Ara t expansin 265 396 89.2 1.2e-19
AAG13596 Ory s 1 275 356 81.1 3.4e-17
BAA85432 Ory s 1 284 262 62.0 2e-11
CAA10346 Cyn d 2 122 227 55.2 9e-10
CAA10345 Dac g 2 122 223 54.4 1.6e-09
CAA10348 Poa p 2 122 223 54.4 1.6e-09
P43214 Phl p 2 122 223 54.4 1.6e-09
P14947 Lol p 2 97 204 50.6 1.7e-08
P93124 Dac g 3 96 200 49.8 3e-08
CAA51775 Lol p 2 88 192 48.3 8.2e-08
2JNZ_A Phl p 3.0101 108 181 45.9 5e-07
AAP80171 Cyn d 15 112 180 45.7 6e-07
P14948 Lol p 3 97 174 44.6 1.2e-06
CAA90746 Tri a 3 118 155 40.6 2.2e-05
A0A077B7S9 Sor h 2.0101 119 120 33.5 0.003
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 281.2 bits 1341,  Expect = 1e-77
 Identities = 191/191 100%, Positives = 191/191 100%, Gaps = 0/191 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  181  DAVYTSNVQFY 191
            DAVYTSNVQFY
Sbjct  181  DAVYTSNVQFY 191

Sequence Alignment: 2. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 277.8 bits 1325,  Expect = 2e-76
 Identities = 186/191 97%, Positives = 191/191 100%, Gaps = 0/191 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTV+ITDMNYEPIAPYHFDLSGKAFG
Sbjct  79   MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFG 138
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            SLAKPGLNDK+RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY+AVLVK+VADDGDI
Sbjct  139  SLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDI 198
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKD+IPANWRP
Sbjct  199  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRP 258
Query  181  DAVYTSNVQFY 191
            DAVYTSNVQFY
Sbjct  259  DAVYTSNVQFY 269

Sequence Alignment: 3. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 237.4 bits 1126,  Expect = 3e-64
 Identities = 158/187 84%, Positives = 173/187 92%, Gaps = 2/187 1%
Query  2    TACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFGS 61
            TACGN PIFKDGKGCGSCYE+RC  KPECSG PVTVFITDMNYEPIAPYHFDLSGKAFG+
Sbjct  79   TACGNPPIFKDGKGCGSCYEIRCN-KPECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGA 137
Query  62   LAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDIV 121
            +AKPGLNDKLRH GI D+EFRRVRCKY  GQKIVFH+EKG NPNY+A+LVKFVADDGDIV
Sbjct  138  MAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIV 197
Query  122  LMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRPD 181
            LME+++K S++WKPMKLSWGAIWRMDT KAL  PFSIRLTSESGKKVIA+D+IP NW+PD
Sbjct  198  LMELKEK-SSDWKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPD 256
Query  182  AVYTSNVQF 190
             VY SNVQF
Sbjct  257  TVYNSNVQF 265

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 216.3 bits 1022,  Expect = 7e-58
 Identities = 135/191 70%, Positives = 162/191 84%, Gaps = 0/191 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            M +CGNVPIFKDG+GCGSCYEV+C++   CS  PVTVFITDMNYEPI+ YHFD+SGKAFG
Sbjct  79   MISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFG 138
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++A PG   +LR  GI+D++FRRVRCKYP GQK+ FH+EKG NPNY+AVLVKFVADDGD+
Sbjct  139  AMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDV 198
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            + M++Q+     W+PMKLSWGAIWRMDTA  LK PFSIR+T+ESGK +IAKD+IP NW P
Sbjct  199  IQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMP 258
Query  181  DAVYTSNVQFY 191
            DA+Y SNVQFY
Sbjct  259  DAIYVSNVQFY 269

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 190.9 bits 897,  Expect = 3e-50
 Identities = 120/188 63%, Positives = 153/188 81%, Gaps = 2/188 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            M +CGN PIFKDGKGCGSC+EV+C  KPE CS  PV + ITDMN EPIA YHFDLSG AF
Sbjct  77   MNSCGNDPIFKDGKGCGSCFEVKCS-KPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            G++AK G +++LR  GI+D++FRRVRCKYP   K+ FH+EKG NPNY AVLVK+V  DGD
Sbjct  136  GAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V +E+++K S EWKP+  SWGAIWR+DT K LKGPFS+R+T+ES +K++A D+IP NW+
Sbjct  196  VVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWK 255
Query  180  PDAVYTSNVQ 189
             +A+Y S +Q
Sbjct  256  ANALYKSEIQ 265

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 190.5 bits 895,  Expect = 4e-50
 Identities = 122/188 64%, Positives = 153/188 81%, Gaps = 2/188 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            M +CGN PIFKDGKGCGSC+E++C  KPE CS  P  + +TDMN EPIA YHFDLSG AF
Sbjct  77   MNSCGNDPIFKDGKGCGSCFEIKCS-KPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            G++AK G +++LR  GI+D +FRRV+CKYPA  KI FHIEK  NPNY+A+LVK+VA DGD
Sbjct  136  GAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E G+K+IA+D IP  W+
Sbjct  196  VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWK 255
Query  180  PDAVYTSNVQ 189
             D+VY SNVQ
Sbjct  256  ADSVYKSNVQ 265

Sequence Alignment: 7. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 189.9 bits 892,  Expect = 5e-50
 Identities = 118/190 62%, Positives = 148/190 77%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            M ACGN PIFKDG GCGSCYE++C +  ECSG PV V ITD NYEPIA YHFDL+G AFG
Sbjct  40   MGACGNPPIFKDGLGCGSCYEIKCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFG 99
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  +KLR  GI+D++FRRV+CKYPA  KI FH+EKGCNPNY A+L+K+ A DGDI
Sbjct  100  AMAKKGEEEKLRKAGIIDMQFRRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDI 159
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I++K S E+ P+K SWGAIWR+D+ K +KGP ++RLTSE G  ++  D IP  W+ 
Sbjct  160  VAVDIKEKGSEEFIPLKHSWGAIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKA 219
Query  181  DAVYTSNVQF 190
            D VYTS +QF
Sbjct  220  DTVYTSKLQF 229

Sequence Alignment: 8. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 189.3 bits 889,  Expect = 8e-50
 Identities = 124/190 65%, Positives = 150/190 78%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MTACGN PIFKDG GC +CYE++CKE  ECSG PV V ITD NYE IA YHFDLSGKAFG
Sbjct  55   MTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFG 114
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+CKYP+G KI FHIEKG N +Y+A+LVK+ A DG+I
Sbjct  115  AMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNI 174
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ + S E+ PMK SWGAIWR+D  K LKGPFSIRLTSE G  ++  D+IPANW+P
Sbjct  175  VAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKP 234
Query  181  DAVYTSNVQF 190
            D VYTS +QF
Sbjct  235  DTVYTSKLQF 244

Sequence Alignment: 9. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 189.3 bits 889,  Expect = 9e-50
 Identities = 119/190 62%, Positives = 151/190 79%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG GCGSC+E++CKE  ECS  PV + ITD NYE IA YHFDLSGKAFG
Sbjct  83   MTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFG 142
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            S+AK G  D LR  G + ++FRRV+C+YP+  KI FH+EKGCN NY+A+LV++ A DGDI
Sbjct  143  SMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDI 202
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S E+ PMK SWGAIWR+D  K LKGPF++RLTSESG K++ +D+IPA+W+P
Sbjct  203  VAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKP 262
Query  181  DAVYTSNVQF 190
            +  YTSN+Q+
Sbjct  263  NTAYTSNLQY 272

Sequence Alignment: 10. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 188.9 bits 887,  Expect = 1e-49
 Identities = 122/190 64%, Positives = 149/190 78%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  73   MTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 132
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG NPNY+A+LVK+ A DG+I
Sbjct  133  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNI 192
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V  +D+IP +W+P
Sbjct  193  VSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKP 252
Query  181  DAVYTSNVQF 190
            D VY S +QF
Sbjct  253  DTVYKSKIQF 262

Sequence Alignment: 11. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 188.9 bits 887,  Expect = 1e-49
 Identities = 122/190 64%, Positives = 149/190 78%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  73   MTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 132
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG NPNY+A+LVK+ A DG+I
Sbjct  133  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNI 192
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V  +D+IP +W+P
Sbjct  193  VSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKP 252
Query  181  DAVYTSNVQF 190
            D VY S +QF
Sbjct  253  DTVYKSKIQF 262

Sequence Alignment: 12. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 187.9 bits 882,  Expect = 2e-49
 Identities = 122/190 64%, Positives = 149/190 78%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  73   MTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 132
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG +PNY+A+LVK+ A DG+I
Sbjct  133  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNI 192
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S  + PMKLSWGAIWRMD  K LKGPF+IRLTSESG  V  +D+IP +W+P
Sbjct  193  VGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKP 252
Query  181  DAVYTSNVQF 190
            D VY S +QF
Sbjct  253  DTVYKSKIQF 262

Sequence Alignment: 13. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 187.3 bits 879,  Expect = 3e-49
 Identities = 121/190 63%, Positives = 148/190 77%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  73   MTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 132
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG NPNY+A+LVK+ A DG+I
Sbjct  133  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNI 192
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V  +D+IP +W+P
Sbjct  193  VSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKP 252
Query  181  DAVYTSNVQF 190
            D VY S +QF
Sbjct  253  DTVYKSKIQF 262

Sequence Alignment: 14. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 186.3 bits 874,  Expect = 6e-49
 Identities = 121/190 63%, Positives = 147/190 77%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  55   MTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 114
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG +PNY+A+LVK+ A DG+I
Sbjct  115  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNI 174
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S E+ PMK SWGAIWRMD  K LKGPF+IRLTSESG  V   D+IP +W+P
Sbjct  175  VGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKP 234
Query  181  DAVYTSNVQF 190
            D VY S +QF
Sbjct  235  DTVYKSKIQF 244

Sequence Alignment: 15. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 186.0 bits 873,  Expect = 8e-49
 Identities = 113/189 59%, Positives = 148/189 78%, Gaps = 1/189 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT+CGN PIFKDGKGCGSCY++RC   P CSGNP TV ITDMNY P++ YHFDLSG AFG
Sbjct  78   MTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFG 137
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AKPG ND+LRH GI+D++F+RV C +P G K+ FH+E+G NP Y AVLV++   DGD+
Sbjct  138  AMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDV 196
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V +++ +  S  W PM+ SWG+IWR+D+   L  PFS+R+T+ESGK+++A  +IPANW P
Sbjct  197  VQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAP 256
Query  181  DAVYTSNVQF 190
             AVY S VQ+
Sbjct  257  MAVYRSFVQY 266

Sequence Alignment: 16. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 185.3 bits 869,  Expect = 1e-48
 Identities = 120/190 63%, Positives = 147/190 77%, Gaps = 0/190 0%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  55   MTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 114
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG +PNY+A+LVK+ A DG+I
Sbjct  115  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNI 174
Query  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
            V ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V   D+IP +W+P
Sbjct  175  VGVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKP 234
Query  181  DAVYTSNVQF 190
            D VY S +QF
Sbjct  235  DTVYKSKIQF 244

Sequence Alignment: 17. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 183.4 bits 860,  Expect = 5e-48
 Identities = 117/189 61%, Positives = 150/189 79%, Gaps = 7/189 3%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT+CGN PIFKDGKGCGSCY++RC + P CSGN  TV ITDMNY P+A YHFDLSG AFG
Sbjct  80   MTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFG 139
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AKPGLNDKLRH GI+D++FRRV C YP G KI FH+E+G NP Y AVLV++   DGD+
Sbjct  140  AMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDV 198
Query  121  VLMEIQDKLSAE------WKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDII 174
            V +++ +  SA       W PM+ SWG+IWR+D+   L+ PFS+R+ S+SGK ++A ++I
Sbjct  199  VQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVI 258
Query  175  PANWRPDAVYTSNVQF 190
            PANW P++ Y S VQF
Sbjct  259  PANWSPNSNYRSIVQF 274

Sequence Alignment: 18. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 179.5 bits 841,  Expect = 8e-47
 Identities = 114/189 60%, Positives = 148/189 78%, Gaps = 7/189 3%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT+CGN P+FKDGKGCGSCY++RC +   CSG   TV ITDMNY P+AP+HFDLSG AFG
Sbjct  91   MTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFG 150
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
             LAKPGLNDKLRH GI+D+EF RV C++P G KI FH+E+  NP Y AVLV++   DGD+
Sbjct  151  RLAKPGLNDKLRHSGIIDIEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDV 209
Query  121  VLMEIQDKLSA------EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDII 174
            V +++ +  +A      +W PM+ SWG+IWR+DT   L+ PFSIR+ +ESGK ++A ++I
Sbjct  210  VQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVI 269
Query  175  PANWRPDAVYTSNVQF 190
            PANWRP+  Y S VQ+
Sbjct  270  PANWRPNTFYRSFVQY 285

Sequence Alignment: 19. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 178.7 bits 837,  Expect = 1e-46
 Identities = 114/185 61%, Positives = 142/185 76%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFK G+GCGSC+E++C  KPE CSG PV V ITD N EPIA YHFDLSG AF
Sbjct  77   MTGCGNTPIFKSGRGCGSCFEIKCT-KPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G   KLR  G ++++FRRV+CKYP G K+ FH+EKG NPNY+A+LVKFVA DGD
Sbjct  136  GSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGAIWR+DT + LKGPF++R T+E G K  AKD+IP  W+
Sbjct  196  VVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y S
Sbjct  256  ADTAYES 262

Sequence Alignment: 20. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 176.9 bits 828,  Expect = 5e-46
 Identities = 110/189 58%, Positives = 143/189 75%, Gaps = 6/189 3%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT+CGN P+F+DGKGCG+CY++RC   P CSG P TV ITDMNY P+A YHFDLSG AFG
Sbjct  67   MTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFG 126
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++A+PGLND+LRH GI+D++FRRV C Y  G  + FH+E G NP Y+AVLV+F   DG +
Sbjct  127  AMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTV 185
Query  121  VLMEIQDKLSAE-----WKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIP 175
            V +++ + L +      W PM+ SWG+IWR+D    L+GP S+R+ SESG+ VIA  +IP
Sbjct  186  VQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIP 245
Query  176  ANWRPDAVYTSNVQF 190
            ANWR +  Y S VQF
Sbjct  246  ANWRANTNYGSKVQF 260

Sequence Alignment: 21. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 175.9 bits 823,  Expect = 9e-46
 Identities = 110/183 60%, Positives = 140/183 76%, Gaps = 2/183 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG PVTV ITD N EPIAPYHFDLSG AF
Sbjct  62   MTGCGNTPIFKDGRGCGSCFEIKCS-KPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G   KLR  G ++++FRRV+CKYP G K  FH+EKG NPNY+A+LVK++  DGD
Sbjct  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K  A+D+IP  W+
Sbjct  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
Query  180  PDAVY 184
             D  Y
Sbjct  241  ADTAY 245

Sequence Alignment: 22. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 175.9 bits 823,  Expect = 9e-46
 Identities = 110/185 59%, Positives = 140/185 75%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFK G+GCGSC+E++C  KPE CSG PV V ITD N EPIAPYHFDLSG AF
Sbjct  77   MTGCGNTPIFKSGRGCGSCFEIKCT-KPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            G++AK G   KLR  G ++++FRRV+CKYP G K+ FH+EKG NPNY+A+LVK+V  DGD
Sbjct  136  GAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGAIWR+DT   L GPF++R T+E G K  A+D+IP  W+
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y S
Sbjct  256  ADTSYES 262

Sequence Alignment: 23. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 175.7 bits 822,  Expect = 1e-45
 Identities = 110/183 60%, Positives = 140/183 76%, Gaps = 2/183 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG PVTV ITD N EPIAPYHFDLSG AF
Sbjct  79   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 137
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G   KLR  G ++++FRRV+CKYP G K  FH+EKG NPNY+A+LVK++  DGD
Sbjct  138  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 197
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K  A+D+IP  W+
Sbjct  198  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 257
Query  180  PDAVY 184
             D  Y
Sbjct  258  ADTAY 262

Sequence Alignment: 24. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 174.9 bits 818,  Expect = 2e-45
 Identities = 108/190 56%, Positives = 147/190 77%, Gaps = 7/190 3%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCK--EKPECSGNPVTVFITDMNYEPIAPYHFDLSGKA 58
            M ACGN PIF  G+GCG CYE++C+    P CSG P  + ITDMNY P+A YH+DLSG A
Sbjct  76   MGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTA 135
Query  59   FGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDG 118
            FGS+AK GLND+LRH GI+D++FRRV C +P G K+ FH+++G NPNY+AVLV++V  DG
Sbjct  136  FGSMAKYGLNDRLRHAGIIDMQFRRVPCNFP-GMKVTFHVQRGSNPNYLAVLVEYVNVDG 194
Query  119  DIVLMEIQDKLSAE----WKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDII 174
             +V ME+   ++      W+ M+ SWG++WRMDT + ++GPFSIR+TS++GK ++A + I
Sbjct  195  TVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAI 254
Query  175  PANWRPDAVYTSNVQFY 191
            PA W+ D  Y SN+QFY
Sbjct  255  PAYWQQDHAYWSNLQFY 271

Sequence Alignment: 25. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 173.0 bits 809,  Expect = 7e-45
 Identities = 107/185 57%, Positives = 141/185 76%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFK G+GCGSC+E++C  KPE CSG P+ V ITD N EPIA YH+DLSGKAF
Sbjct  77   MTGCGNTPIFKSGRGCGSCFEIKCT-KPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            G++AK G   KLR  G ++++FRRV+C+YP G K+ FH+EKG NPNY+A+LVK+V  DGD
Sbjct  136  GAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G KV A+D+IP  W+
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y S
Sbjct  256  ADTAYES 262

Sequence Alignment: 26. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 172.6 bits 807,  Expect = 9e-45
 Identities = 108/185 58%, Positives = 140/185 75%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFK G+GCGSC+E++C  KPE CSG PV V ITD N EPIA YHFDLSGKAF
Sbjct  77   MTGCGNTPIFKSGRGCGSCFEIKCT-KPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            G++AK G   KLR  G ++++FRRV+C+YP G K+ FH+EKG NPNY+A+LVK+V  DGD
Sbjct  136  GAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWG+IWR+DT   L GPF++R T+E G K  A+D+IP  W+
Sbjct  196  VVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y S
Sbjct  256  ADTAYAS 262

Sequence Alignment: 27. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 172.4 bits 806,  Expect = 1e-44
 Identities = 108/185 58%, Positives = 139/185 75%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLSG AF
Sbjct  77   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G   KLR  G ++++FRRV+CKYP G K  FH+EK  NPNY+A+LVK+V  DGD
Sbjct  136  GSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y++
Sbjct  256  ADTSYSA 262

Sequence Alignment: 28. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 171.6 bits 802,  Expect = 2e-44
 Identities = 107/180 59%, Positives = 138/180 76%, Gaps = 2/180 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG P+TV ITD N EPIAPYHFDLSG AF
Sbjct  83   MTGCGNTPIFKDGRGCGSCFELKCS-KPESCSGEPITVHITDDNEEPIAPYHFDLSGHAF 141
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G  + +R  G ++++FRRV+CKYP G K  FH+EKG NPNY+A+LVK+V  DGD
Sbjct  142  GSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGD 201
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGAIWR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  202  VVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWK 261
Query  180  PD 181
             D
Sbjct  262  AD 263

Sequence Alignment: 29. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 170.2 bits 795,  Expect = 5e-44
 Identities = 106/185 57%, Positives = 138/185 74%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLSG AF
Sbjct  66   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 124
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G    +R  G ++++FRRV+CKYP   K  FH+EKG NPNY+A+LVK+V  DGD
Sbjct  125  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGD 184
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  185  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWK 244
Query  180  PDAVYTS 186
             D  Y++
Sbjct  245  ADTSYSA 251

Sequence Alignment: 30. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 168.4 bits 786,  Expect = 2e-43
 Identities = 105/185 56%, Positives = 137/185 74%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLSG AF
Sbjct  77   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G    +R  G ++++FRRV+CKYP   K  FH+EK  NPNY+A+LVK+V  DGD
Sbjct  136  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  196  VVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y++
Sbjct  256  ADTSYSA 262

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 168.2 bits 785,  Expect = 2e-43
 Identities = 114/184 61%, Positives = 142/184 77%, Gaps = 6/184 3%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            M +CGN PIFKDGKGCGSC+E++C  KPE CS  P  + +TDMN EPIA YHFDLSG A 
Sbjct  77   MNSCGNDPIFKDGKGCGSCFEIKCS-KPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA- 134
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
              +AK G +++LR  GI+D +FRRV+CKYPA  KI FHIEK  NPNY+A+LVK+VA DGD
Sbjct  135  --MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGD 192
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E  ++  A+D IP   R
Sbjct  193  VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPDPGR 252
Query  180  PDAVYTSNVQ 189
               V   NVQ
Sbjct  253  RQRVQV-NVQ 261

Sequence Alignment: 32. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 168.0 bits 784,  Expect = 2e-43
 Identities = 105/185 56%, Positives = 137/185 74%, Gaps = 2/185 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLSG AF
Sbjct  77   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
Query  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
            GS+AK G    +R  G ++++FRRV+CKYP   K  FH+EK  NPNY+A+LVK+V  DGD
Sbjct  136  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGD 195
Query  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWK 255
Query  180  PDAVYTS 186
             D  Y++
Sbjct  256  ADTSYSA 262

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 167.5 bits 782,  Expect = 3e-43
 Identities = 104/189 55%, Positives = 140/189 74%, Gaps = 3/189 1%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT+CGN P++K GKGCGSCY VRC   P CSGN  TV ITDMNY P++ YHFDLSG AFG
Sbjct  79   MTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFG 138
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
             LAKPG  D LR  GI+DV+F RV C++P G K+ FH+E+G +P Y+AVLV++   DGD+
Sbjct  139  RLAKPGRADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDV 197
Query  121  VLMEIQDKLSA--EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANW 178
              +++++  +    W PM+ SWG++WR+D+   L+ PFSIR+ S+SGK ++A D+IP NW
Sbjct  198  AQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNW 257
Query  179  RPDAVYTSNVQF 190
             P+  Y S VQ+
Sbjct  258  TPNTFYRSFVQY 269

Sequence Alignment: 34. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 161.7 bits 753,  Expect = 2e-41
 Identities = 105/183 57%, Positives = 140/183 76%, Gaps = 5/183 2%
Query  1    MTACGNVPIFKDGKGCGSCYEVRC-KEKP-ECSGNPVTVFITDMNYEPIAPYHFDLSGKA 58
            M ACGN+PIFKDG  CGSC+E++C K KP ECSG  V V ITDMNYE IA YHFDL+G A
Sbjct  54   MGACGNLPIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHA 112
Query  59   FGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDG 118
            FG++AK G  +KL   GI+D++FRRV+CKY  G+K+ FH+EKG NPNY+A+LVK+V  DG
Sbjct  113  FGAMAKKGQEEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDG 170
Query  119  DIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANW 178
            DIV ++I++K    ++P+K SWGAIWR D+   +K P ++++T+E G K    D+IP  W
Sbjct  171  DIVGVDIKEKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGW 230
Query  179  RPDAVYTS 186
            + D  YT+
Sbjct  231  KADTTYTA 238

Sequence Alignment: 35. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 136.1 bits 627,  Expect = 9e-34
 Identities = 88/189 46%, Positives = 124/189 65%, Gaps = 5/189 2%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITD--MNYEPIAPYHFDLSGKA 58
            + + G+  I+  GKGCGSCYEV+C     CSGNPV V ITD        A YHFDLSG A
Sbjct  83   LISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNA 142
Query  59   FGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDG 118
            FG++A  G ++ LR+ G ++++ RR+ C YP G+ I FH++ G N  Y A LV++   DG
Sbjct  143  FGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYEDGDG 201
Query  119  DIVLMEIQDKL-SAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS-ESGKKVIAKDIIPA 176
            D+  +E+++ L S  W  M+ SWGA+W+ D    L+ PFSI+LT+ ESG+ ++A ++IPA
Sbjct  202  DLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPA 261
Query  177  NWRPDAVYTSNVQF 190
             W P   Y S V F
Sbjct  262  GWTPGQTYRSIVNF 275

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 129.4 bits 594,  Expect = 1e-31
 Identities = 83/188 44%, Positives = 123/188 65%, Gaps = 8/188 4%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIA---PYHFDLSGK 57
            M A G   +FK+GKGCGSCY+++C     CSG PVTV ITD     +      HFD+SG 
Sbjct  80   MIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGT 139
Query  58   AFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADD 117
            AFG++A  G+ D+LR  G++ ++++RV C++     + F ++ G NP Y+A+LV++   D
Sbjct  140  AFGAMANRGMGDRLRSAGVLKIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGD 197
Query  118  GDIVLMEI-QDKLSAEWKPMKLSWGAIWRMD--TAKALKGPFSIRLTSESGKKVIAKDII 174
            GD+  + I + +    WK M+ SWGA WR++  T K L  PFSIRLTS SGK ++A ++I
Sbjct  198  GDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVI 257
Query  175  PANWRPDAVYTSNVQF 190
            P+ W+    Y S V +
Sbjct  258  PSGWQAGLTYRSTVNY 273

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 126.1 bits 578,  Expect = 1e-30
 Identities = 113/189 59%, Positives = 149/189 78%, Gaps = 11/189 5%
Query  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
            MT+CGN P+FKDGKGCGSCY++RC   P CSG P TV ITDMNY P++ YHFDLSG AFG
Sbjct  128  MTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFG 187
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
            ++AK   ND+LRH GI+D++FRRV C+YP G  + FH+E+G NP Y+A+LV++   DGD+
Sbjct  188  AMAKDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDV 246
Query  121  V---LME-------IQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIA 170
            V   LME       +    +  W PM+ SWG+IWR+DT   L+GPFS+R+T+ESGK +IA
Sbjct  247  VQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIA 306
Query  171  KDIIPANWRPDAVYTSNVQF 190
              +IPA+W+P+ VY+S VQF
Sbjct  307  DQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 89.2 bits 396,  Expect = 1e-19
 Identities = 67/176 38%, Positives = 102/176 57%, Gaps = 11/176 6%
Query  9    IFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFGSLAKP--G 66
            I+KDG GCG+C++VRCK    CS    TV +TD+N        + LS +AF ++AKP  G
Sbjct  66   IYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN--KTNQTDLVLSSRAFRAMAKPVVG 123
Query  67   LNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC-NPNYVAVLVKFVADDGDIVLMEI 125
             +  L   GI+D+E+RRV C Y   +K+   +E+   NPNY+A+ + +     ++V + I
Sbjct  124  ADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYI 182
Query  126  QDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESG---KKVIAKDIIPANWRPDA 182
                S+ W  M  S GA+W  D  K   G +  R+   +G   K V ++ ++PANW    
Sbjct  183  AQVGSSHWSYMTRSHGAVWVTD--KVPNGALQFRFVVTAGYDGKMVWSQRVLPANWEAGK 240
Query  183  VYTSNVQ 189
             Y + VQ
Sbjct  241  SYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 81.1 bits 356,  Expect = 3e-17
 Identities = 64/181 35%, Positives = 103/181 56%, Gaps = 14/181 7%
Query  3    ACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDL--SGKAFG 60
            A  +  +F+ G GCG+C++VRCK+   CS     V +TD   E  +    DL  S  A+ 
Sbjct  69   AAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD---EARSTNRTDLVLSAAAYA 125
Query  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDG-- 118
            ++A+PG+  +LR    +DVE++RV C+Y AG+ +   +E+   P    + ++F+   G  
Sbjct  126  AMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPR-ELSIRFLYQGGQT 184
Query  119  DIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT---SESGKKVIAK-DII 174
            DIV +++    S+ WK M   +G  W   TA+A  GP+  R+       GK V A  +++
Sbjct  185  DIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVVTGGYDGKWVWADGEVL 242
Query  175  PANWRPDAVYTSNVQ 189
            P  W    VY + VQ
Sbjct  243  PRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 62.0 bits 262,  Expect = 2e-11
 Identities = 59/178 33%, Positives = 96/178 53%, Gaps = 30/178 16%
Query  2    TACGNVPIFKDGKGCGSCYEVRCKEKPECS-GNPVTVFITDMNYEPIAPY---------- 50
            TA  + P+F DG GCG CYE+RC + P C+ G+P +V IT  N  P   Y          
Sbjct  89   TAALSTPLFADGNGCGQCYELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCN 147
Query  51   ----HFDLSGKAFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 106
                HFD++  +F  LA+       R  GI+ V++RRV C+   G +  +   +G N  +
Sbjct  148  PPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QG-NHYW 196
Query  107  VAVLVKFVADDGDIVLMEIQDKLSA-EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESG 165
            + + V  V   GD+  + ++       W     +WG  +++  A      ++++LT+ S 
Sbjct  197  LLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYST 256
Query  166  KK--VIAKDIIPANWRPDAVYTSNVQFY 191
             +  +I  D I   W     Y  +  FY
Sbjct  257  PQQTIIVSDAISPWWITGLCYQGSNNFY 284

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 55.2 bits 227,  Expect = 9e-10
 Identities = 33/90 36%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ F +EKG N  ++AVLVK+  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
            KGPF+ R+ +E G K +  D++P  +   A Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 54.4 bits 223,  Expect = 2e-09
 Identities = 32/90 35%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ F +EKG N  ++AVLVK+  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
            +GPF+ R+ +E G K +  D++P  +   A Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 54.4 bits 223,  Expect = 2e-09
 Identities = 32/90 35%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ F +EKG N  ++AVLVK+  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
            +GPF+ R+ +E G K +  D++P  +   A Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 54.4 bits 223,  Expect = 2e-09
 Identities = 32/90 35%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ F +EKG N  ++AVLVK+  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
            +GPF+ R+ +E G K +  D++P  +   A Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 50.6 bits 204,  Expect = 2e-08
 Identities = 26/91 28%, Positives = 53/91 58%, Gaps = 0/91 0%
Query  94   IVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALK 153
            + F +EKG +   +A+ +K+  +   +  +E+++  S EW  +K +   +W + + K LK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  154  GPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
            GPF+ R+ SE G + +  D++PA+++    Y
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 49.8 bits 200,  Expect = 3e-08
 Identities = 26/92 28%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ F +EKG +P  + + +K+      +  +E++   S EW+P+    G +W + ++K L
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLT-KKGNLWEVKSSKPL 60
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVYT 185
             GPF+ R+ S+ G + +  ++IP  ++    YT
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 48.3 bits 192,  Expect = 8e-08
 Identities = 25/84 29%, Positives = 50/84 59%, Gaps = 0/84 0%
Query  96   FHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGP 155
            F +EKG +   +A+ +K+  +   +  +E+++  S EW  +K +   +W + + K LKGP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  156  FSIRLTSESGKKVIAKDIIPANWR 179
            F+ R+ SE G   +  D++PA+++
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFK 85

Sequence Alignment: 48. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 45.9 bits 181,  Expect = 5e-07
 Identities = 23/91 25%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            ++ F ++KG +P  + + +K+      +  +E++   S EW+P+    G +W + ++K L
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLT-KKGNVWEVKSSKPL 72
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
             GPF+ R+ S+ G + +  ++IP  +     Y
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104

Sequence Alignment: 49. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 45.7 bits 180,  Expect = 6e-07
 Identities = 32/90 35%, Positives = 56/90 62%, Gaps = 7/90 7%
Query  94   IVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALK 153
            I+FH+E+  +P + A+ +K  A +  I  +++++  +    PM  S G  W +D  K LK
Sbjct  22   IIFHVEES-SPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  154  GPFSIRLTSESGKKVIAKDIIPANWRPDAVYTSNVQF 190
            GP++IRL +E G   +  D+IP NW+    Y + ++F
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 44.6 bits 174,  Expect = 1e-06
 Identities = 26/92 28%, Positives = 49/92 53%, Gaps = 1/92 1%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ + +EKG +   + + +K+      +  +E++   S EW+PM    G +W + +AK L
Sbjct  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMT-KKGNLWEVKSAKPL 60
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVYT 185
             GP + R+ S+ G K +  ++IP  +     YT
Sbjct  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93

Sequence Alignment: 51. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 40.6 bits 155,  Expect = 2e-05
 Identities = 21/91 23%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
            K+ + ++KG +   +A+ + +   +  +  +E++   S EW+P+    G +W +  +K L
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLT-KKGDVWEVSCSKPL 82
Query  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184
             GPF+ R+ S++G K +  ++   +++    Y
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

Sequence Alignment: 52. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 33.5 bits 120,  Expect = 0.003
 Identities = 18/71 25%, Positives = 41/71 57%, Gaps = 1/71 1%
Query  119  DIVLMEIQDKLSAEWKP-MKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPAN 177
            D+  + ++DK + ++   +K S    +  ++ + +KGP+S+R+  +        D+IPA+
Sbjct  47   DVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPAD 106
Query  178  WRPDAVYTSNVQ 189
            ++P +VY +  Q
Sbjct  107  FKPGSVYKTKEQ 118

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.