The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEE
DELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
Sequence Info Allergen Name Length Opt Bits Score E Value
AM904681 Lep w 1.0101 109 695 97.9 6.7e-23
CAC83658 Cyp c 1.01 109 482 71.4 6.4e-15
P59747 Sco j 1 109 482 71.4 6.4e-15
CAC83659 Cyp c 1.02 109 473 70.2 1.4e-14
A0A1B1V0G7 Ras k 1.0101 109 472 70.1 1.5e-14
FM202668 Xip g 1.0101 109 468 69.6 2.1e-14
Q90YK7 The c 1 109 466 69.4 2.6e-14
Q5IRB2 Lat c 1.0101 109 464 69.1 3e-14
Q6ITU9 Lat c 1.0201 109 462 68.9 3.6e-14
CAA66404 Sal s 1 108 461 68.7 3.9e-14
XP_026772003 Pan h 1.0101 109 461 68.7 3.9e-14
QCY53440 Cten i 1.0101 109 461 68.7 3.9e-14
CAQ72967 Thu a 1.0101 109 459 68.5 4.7e-14
Q91483 Sal s 1 107 454 67.9 7.1e-14
CAQ72971 Clu h 1.0201 110 442 66.4 2e-13
CAQ72968 Seb m 1.0101 109 437 65.7 3.1e-13
CAM56785 Gad m 1.0102 109 437 65.7 3.1e-13
FM177701 Sar sa 1.0101 109 435 65.5 3.7e-13
XP_019397705 Cro p 1.0101 109 434 65.4 4e-13
AAK63086 Gad m 1.0101 109 433 65.3 4.4e-13
CAQ72969 Seb m 1.0201 110 433 65.3 4.4e-13
CAM56786 Gad m 1.0202 109 430 64.9 5.7e-13
Q90YK9 Gad m 1.0201 109 428 64.6 6.8e-13
AAK63087 Gad m 1.0201 109 428 64.6 6.8e-13
CAQ72972 Clu h 1.0301 109 424 64.1 9.6e-13
CAQ72970 Clu h 1.0101 109 419 63.5 1.5e-12
Q91482 Sal s 1 109 408 62.1 3.8e-12
P86432 Onc m 1.0201 107 393 60.3 1.4e-11
CAC95152 Ran e 2 109 392 60.1 1.5e-11
XP_019400389 Cro p 2.0101 110 373 57.8 7.9e-11
XP_026803769 Pan h 1.0201 109 360 56.2 2.4e-10
C1L370 Gal d 8.0101 110 359 56.0 2.6e-10
P86431 Onc m 1.0101 108 355 55.5 3.7e-10
P02622 Gad c 1 113 350 54.9 5.8e-10
CAC83046 Ran e 1 110 346 54.4 8.1e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 97.9 bits 695,  Expect = 7e-23
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEE 60
            MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEE
Sbjct  1    MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEE 60
Query  61   DELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK 109
            DELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
Sbjct  61   DELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK 109

Sequence Alignment: 2. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 71.4 bits 482,  Expect = 6e-15
 Identities = 75/108 69%, Positives = 87/108 80%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL GC AADSFDYK FF   GL+ K+ +++K AF  IDQD+SGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNFSA ARALTD ET  FLKAGD DGDGKIG++EF  LV++
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 3. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 71.4 bits 482,  Expect = 6e-15
 Identities = 75/107 70%, Positives = 86/107 80%, Gaps = 1/107 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FA  L  AE+ AALDGC AA SFD+KKFF ACGL+ KS +EVK AF  IDQD+SGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            E+ELKLFLQNF A ARAL+D ET  FLKAGD DGDGKIGI+EF  +++
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 4. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 70.2 bits 473,  Expect = 1e-14
 Identities = 75/108 69%, Positives = 87/108 80%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL+ C AADSF++K FF   GL  KSA++VK AF  IDQD+SGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNF A ARALTD ET  FLKAGD DGDGKIG++EFT LV++
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 5. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 70.1 bits 472,  Expect = 2e-14
 Identities = 73/107 68%, Positives = 84/107 78%, Gaps = 1/107 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FA  L  AEI AALDGC A  SFD+KKFF ACGLA KS ++VK AF  IDQD+SGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            E+ELKLFLQNF A AR L+D ET  FLKAGD DGDGKIG++EF  +++
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 6. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 69.6 bits 468,  Expect = 2e-14
 Identities = 74/106 69%, Positives = 83/106 78%, Gaps = 1/106 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L  A++ AAL+ C  A +FDYKKFF +CGLA KS ++VK AF  IDQD+SGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
            EDELKLFLQNF A+AR LTD ET  FLKAGD DGDGKIG EEF  LV
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALV 107

Sequence Alignment: 7. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 69.4 bits 466,  Expect = 3e-14
 Identities = 72/108 66%, Positives = 88/108 81%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L  AE+ AAL+ C +A SFD+ KFF +CGLA KS+++VK AF  IDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            E+ELKLFLQNFSASARAL+D ET  FLKAGD DGDGKIG++EF  +V++
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 8. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 69.1 bits 464,  Expect = 3e-14
 Identities = 76/107 71%, Positives = 85/107 79%, Gaps = 1/107 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL  C AADSF +K FF   GLA KS ++VK AF  IDQD+SGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            EDELKLFLQNFSASARALTD ET  FLKAGD DGDGKIG++EF  LV+
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 9. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 68.9 bits 462,  Expect = 4e-14
 Identities = 70/107 65%, Positives = 86/107 80%, Gaps = 1/107 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M F+  L  +++ AALDGC  A +FD+KKFF ACGL+ K++++VK AF  IDQD+SGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            E+ELKLFLQNF A AR LTD ET+ FLKAGD DGDGKIG +EFT LV+
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 10. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 68.7 bits 461,  Expect = 4e-14
 Identities = 70/107 65%, Positives = 85/107 79%, Gaps = 0/107 0%
Query  1    MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEE 60
            M+FAGL+ A++ AAL  C AADSF++K FF   GLA KS+++VK AF  IDQD+SGFIEE
Sbjct  1    MSFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 60
Query  61   DELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            DELKLFLQNFSASARALTD ET  FL  GD DGDG IG++EF  +++
Sbjct  61   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 11. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 68.7 bits 461,  Expect = 4e-14
 Identities = 73/108 67%, Positives = 85/108 78%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AALD C A  SFD+K FF   GL  KSA++VK AF+ IDQD+SGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNF + ARALTD ET  FLKAGD DGDGKIG++EF  LV++
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 12. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 68.7 bits 461,  Expect = 4e-14
 Identities = 73/108 67%, Positives = 86/108 79%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL+ C AADSF++K FF   GL+ KS ++VK AF  IDQD+SGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNF A ARALTD ET  FLKAGD DGDGKIG++EF  LV++
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 13. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 68.5 bits 459,  Expect = 5e-14
 Identities = 75/108 69%, Positives = 83/108 76%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L  A+I AAL  C AADSF YK FF   GLA K+ E++K AF  IDQD+SGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNFSA ARALTD ET  FL AGD DGDGKIGI+EF  LV++
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 14. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 67.9 bits 454,  Expect = 7e-14
 Identities = 69/106 65%, Positives = 84/106 79%, Gaps = 0/106 0%
Query  2    TFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEED 61
            +FAGL+ A++ AAL  C AADSF++K FF   GLA KS+++VK AF  IDQD+SGFIEED
Sbjct  1    SFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEED 60
Query  62   ELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            ELKLFLQNFSASARALTD ET  FL  GD DGDG IG++EF  +++
Sbjct  61   ELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 15. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 66.4 bits 442,  Expect = 2e-13
 Identities = 69/109 63%, Positives = 84/109 77%, Gaps = 1/109 0%
Query  1    MTFAGL-DAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAGL   A+I AAL  C AAD+FD+K FF   GL+ KSA++VK  F  IDQD+SGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK 109
            E+ELKLFLQNF A ARAL+DKET  FL AGD DGDG IG++EF  +V+++
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR 110

Sequence Alignment: 16. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 65.7 bits 437,  Expect = 3e-13
 Identities = 66/104 63%, Positives = 83/104 79%, Gaps = 0/104 0%
Query  4    AGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDEL 63
            A L+AA+I AAL  C+  D+F +K FFG  GL+ KSA+++K AF  IDQD+SGFIEE+EL
Sbjct  5    ASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIEEEEL 64
Query  64   KLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            KLFLQNFSA+ARALT+ ET  FLKAGD DGDG IG++EF  +V+
Sbjct  65   KLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 17. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 65.7 bits 437,  Expect = 3e-13
 Identities = 70/108 64%, Positives = 83/108 76%, Gaps = 1/108 0%
Query  1    MTFAGLDA-AEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG+ A A+  AA+  C AA+SF YK FF  CGL+ KSA+++K AF  IDQD+SGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQ F A ARALTD ET  FLKAGD DGDG IG+EE+  LV++
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 18. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 65.5 bits 435,  Expect = 4e-13
 Identities = 71/107 66%, Positives = 83/107 77%, Gaps = 1/107 0%
Query  1    MTFAGL-DAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M +AGL   A+I AAL+ C AADSFD+K FF   G++ KSA+E+K AF  IDQD+SGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            E+ELKLFLQNF   ARALTD ET  FLKAGD  GDGKIGI+EF  LV+
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 19. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 65.4 bits 434,  Expect = 4e-13
 Identities = 66/103 64%, Positives = 81/103 78%, Gaps = 0/103 0%
Query  6    LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKL 65
            L A +I+AAL  C AA+SF+YK FF   GL  KSA++VK  F  +DQD+SGFIEEDEL+L
Sbjct  7    LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQL 66
Query  66   FLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            FL+NFS+SARALTD ET  FL AGD DGDGKIG++EF  LV++
Sbjct  67   FLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 20. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 65.3 bits 433,  Expect = 4e-13
 Identities = 69/108 63%, Positives = 83/108 76%, Gaps = 1/108 0%
Query  1    MTFAGLDA-AEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG+ A A+  AA+  C AA+SF YK FF  CGL+ KSA+++K AF  IDQD+SGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQ F A ARALTD ET  FLKAGD DGDG IG++E+  LV++
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 21. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 65.3 bits 433,  Expect = 4e-13
 Identities = 69/107 64%, Positives = 81/107 75%, Gaps = 2/107 1%
Query  1    MTFA--GLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFI 58
            M FA  GL  A+I AALDGC  A  F++K FF  CGL+ KS++EVK AF  IDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  59   EEDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            EE+ELKLFLQ F A ARAL+D ET  FLKAGD DGDGKIG +E+  +V+
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 22. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 64.9 bits 430,  Expect = 6e-13
 Identities = 67/108 62%, Positives = 82/108 75%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL  C A  SFD+K FF   GLA KS+ ++K  F  IDQD+S F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNFSA ARAL+D ET  FLKAGD DGDGKIG++EF  ++++
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 23. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 64.6 bits 428,  Expect = 7e-13
 Identities = 67/108 62%, Positives = 81/108 75%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL  C A  SFD+K FF   GLA KS  ++K  F  IDQD+S F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNFSA ARAL+D ET  FLKAGD DGDGKIG++EF  ++++
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 24. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 64.6 bits 428,  Expect = 7e-13
 Identities = 67/108 62%, Positives = 81/108 75%, Gaps = 1/108 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FAG L+ A+I AAL  C A  SFD+K FF   GLA KS  ++K  F  IDQD+S F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            EDELKLFLQNFSA ARAL+D ET  FLKAGD DGDGKIG++EF  ++++
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 25. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 64.1 bits 424,  Expect = 1e-12
 Identities = 69/106 65%, Positives = 77/106 72%, Gaps = 1/106 0%
Query  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M FA  L  A+I AAL  C  ADSFD+K FF   GL  KS +E+K AF  IDQD+SGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
            E+ELKLFLQNF   ARALTD ET  FLKAGD D DGKIGI+EF  L+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 26. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 63.5 bits 419,  Expect = 1e-12
 Identities = 67/107 62%, Positives = 79/107 73%, Gaps = 1/107 0%
Query  1    MTFAGL-DAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
            M +A L   A+I AAL  C A DSF +K FF   GLA KSA ++K AF  IDQD+SGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            E+ELKLFLQNF A ARALTD ET  FLKAGD DGDG IG++EF  +++
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 27. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 62.1 bits 408,  Expect = 4e-12
 Identities = 64/99 64%, Positives = 74/99 74%, Gaps = 0/99 0%
Query  9    AEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQ 68
            A+IK AL+ C AAD+F +K FF   G+A KSA++VK AF  IDQD SGFIE +ELKLFLQ
Sbjct  10   ADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQ 69
Query  69   NFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            NF   AR LTD ET  FLKAGD DGDG IGI+EF  LV+
Sbjct  70   NFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 28. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 60.3 bits 393,  Expect = 1e-11
 Identities = 61/106 57%, Positives = 77/106 72%, Gaps = 0/106 0%
Query  2    TFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEED 61
            +FAGL+ A++ AAL  CAAADSF++K FF        S +++K     +DQD+SGF+EED
Sbjct  1    SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED 60
Query  62   ELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            ELKLFLQNFSASARALTD ET     AGD DGDG +G++EF  LV+
Sbjct  61   ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 29. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 60.1 bits 392,  Expect = 2e-11
 Identities = 62/99 62%, Positives = 75/99 75%, Gaps = 0/99 0%
Query  10   EIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQN 69
            +I AAL+   AA SF+YK FF   GLA KSA + K  F  +D+D+SGFIE+DEL LFLQN
Sbjct  11   DIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIEQDELGLFLQN 70
Query  70   FSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108
            F ASAR L+D ET+ FLKAGD DGDGKIG+EEF  LV++
Sbjct  71   FRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 30. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 57.8 bits 373,  Expect = 8e-11
 Identities = 59/101 58%, Positives = 75/101 74%, Gaps = 0/101 0%
Query  6    LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKL 65
            L A +IK A+   AAA+SF++KKFF   GL KKS ++VK  F+ +D+D SGFIEEDELK 
Sbjct  7    LSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIEEDELKS 66
Query  66   FLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
             L+ F+  AR L+DKET  +L AGD DGDGKIG++EFT LV
Sbjct  67   VLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 31. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 56.2 bits 360,  Expect = 2e-10
 Identities = 60/101 59%, Positives = 69/101 68%, Gaps = 0/101 0%
Query  6    LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKL 65
            L A +IK ALD    AD+FD+KKFF   GL   SAE VK  F+ +D D SGFIEEDELK+
Sbjct  7    LKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIEEDELKF 66
Query  66   FLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
             L+ FS   R LTDKET  FL A D DGDGKIGI+EF  +V
Sbjct  67   VLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 32. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 56.0 bits 359,  Expect = 3e-10
 Identities = 56/101 55%, Positives = 73/101 72%, Gaps = 0/101 0%
Query  6    LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKL 65
            L A +IK A+   +AA+SF+YKKFF   GL KKS E+VK  F+ +D+D SGFIEE+ELK+
Sbjct  7    LSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIEEEELKF 66
Query  66   FLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
             L+ F+   R L+DKET  +L AGD DGDGKIG +EF  +V
Sbjct  67   VLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 33. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 55.5 bits 355,  Expect = 4e-10
 Identities = 54/99 54%, Positives = 69/99 69%, Gaps = 0/99 0%
Query  9    AEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQ 68
            A++K AL+ C AADSF++K FF   G+A K  ++VK     +DQD SGF+E +ELKLFLQ
Sbjct  9    ADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQ 68
Query  69   NFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107
            NF      LTD ET  FLKAGD DGDG +G++EF  LV+
Sbjct  69   NFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 34. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 54.9 bits 350,  Expect = 6e-10
 Identities = 60/104 57%, Positives = 69/104 66%, Gaps = 1/104 0%
Query  3    FAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEED 61
            F G L  A+IKAA   C    SFD   F+   GL   SA+E+K  F   D+D+ GFIEED
Sbjct  2    FKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEED 61
Query  62   ELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
            ELKLFL  F+A  RALTD ET  FLKAGD DGDGKIG++EF  LV
Sbjct  62   ELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 54.4 bits 346,  Expect = 8e-10
 Identities = 53/101 52%, Positives = 72/101 71%, Gaps = 0/101 0%
Query  6    LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKL 65
            L A +I  A+   AA +SF++KKFF  CGL  KS E ++  F+ +DQD+SGFIE++EL L
Sbjct  7    LAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIEKEELCL 66
Query  66   FLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLV 106
             L+ F+   R+L+DKET  +L AGD DGDGKIG++EF  LV
Sbjct  67   ILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.