The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTFLIQSAFVALAAISAVLCDPVVVPLQKRAPVEEYINTQYVGPVQLGNQYFLCVFDTSS
YTTVIPSASCVSGGCNCANVHKYYSNKPVSNNVASVRILGSGYANGSEAHDYIAVSTLNA
TNQGFLLADDISNDICSLGADCVIGLGRPKSGRAAFNLPTVMENFVNQDNIANSFSFHHG
RYPDGQHRGVLVLGGTIPAYYRGDFTYVPLVDKDTWNFKVDSISVGNEVVATDQLAFVDS
SKYVITGPAEEIKKINDRLGCTNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTY
HIQQNGDLCYSGFQYSAGKCFHFGDFFMDNYYAKFDGQNKRMGFAKSVEEL
Sequence Info Allergen Name Length Opt Bits Score E Value
E7BQV5 Per a 2.0101 351 2368 546.2 7.5e-157
P54958 Bla g 2 352 985 231.0 6e-62
Q03168 Aed a 11.0101 387 498 119.9 1.7e-28
I1CLC6 Rhi o 1.0101 401 411 100.1 1.7e-22
CAA59419 Asp f 10 395 247 62.7 3e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 2.0101 Sequence ID: E7BQV5

 Score = 546.2 bits 2368,  Expect = 8e-157
 Identities = 351/351 100%, Positives = 351/351 100%, Gaps = 0/351 0%
Query  1    MTFLIQSAFVALAAISAVLCDPVVVPLQKRAPVEEYINTQYVGPVQLGNQYFLCVFDTSS 60
            MTFLIQSAFVALAAISAVLCDPVVVPLQKRAPVEEYINTQYVGPVQLGNQYFLCVFDTSS
Sbjct  1    MTFLIQSAFVALAAISAVLCDPVVVPLQKRAPVEEYINTQYVGPVQLGNQYFLCVFDTSS 60
Query  61   YTTVIPSASCVSGGCNCANVHKYYSNKPVSNNVASVRILGSGYANGSEAHDYIAVSTLNA 120
            YTTVIPSASCVSGGCNCANVHKYYSNKPVSNNVASVRILGSGYANGSEAHDYIAVSTLNA
Sbjct  61   YTTVIPSASCVSGGCNCANVHKYYSNKPVSNNVASVRILGSGYANGSEAHDYIAVSTLNA 120
Query  121  TNQGFLLADDISNDICSLGADCVIGLGRPKSGRAAFNLPTVMENFVNQDNIANSFSFHHG 180
            TNQGFLLADDISNDICSLGADCVIGLGRPKSGRAAFNLPTVMENFVNQDNIANSFSFHHG
Sbjct  121  TNQGFLLADDISNDICSLGADCVIGLGRPKSGRAAFNLPTVMENFVNQDNIANSFSFHHG 180
Query  181  RYPDGQHRGVLVLGGTIPAYYRGDFTYVPLVDKDTWNFKVDSISVGNEVVATDQLAFVDS 240
            RYPDGQHRGVLVLGGTIPAYYRGDFTYVPLVDKDTWNFKVDSISVGNEVVATDQLAFVDS
Sbjct  181  RYPDGQHRGVLVLGGTIPAYYRGDFTYVPLVDKDTWNFKVDSISVGNEVVATDQLAFVDS 240
Query  241  SKYVITGPAEEIKKINDRLGCTNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTY 300
            SKYVITGPAEEIKKINDRLGCTNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTY
Sbjct  241  SKYVITGPAEEIKKINDRLGCTNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTY 300
Query  301  HIQQNGDLCYSGFQYSAGKCFHFGDFFMDNYYAKFDGQNKRMGFAKSVEEL 351
            HIQQNGDLCYSGFQYSAGKCFHFGDFFMDNYYAKFDGQNKRMGFAKSVEEL
Sbjct  301  HIQQNGDLCYSGFQYSAGKCFHFGDFFMDNYYAKFDGQNKRMGFAKSVEEL 351

Sequence Alignment: 2. Allergen Name: Bla g 2 Sequence ID: P54958

 Score = 231.0 bits 985,  Expect = 6e-62
 Identities = 147/321 45%, Positives = 209/321 65%, Gaps = 9/321 2%
Query  25   VPLQKRAPVEEYINTQYVGPVQLGNQYFLCVFDTSSYTTVIPSASCVSGGCNCANVHKYY 84
            VPL K   V  +INTQY G  ++GNQ FL VFD++S   V+ S  CV G C C N++KY 
Sbjct  25   VPLYKLVHV--FINTQYAGITKIGNQNFLTVFDSTSCNVVVASQECVGGACVCPNLQKYE 82
Query  85   SNKP--VSNNVASVRILGSGYANGSEAHDYIAVSTLNATNQGFLLADDISNDICSLGADC 142
              KP  +S+    V+ + +G A G    D + +S L  + Q  +LAD++S ++C L AD 
Sbjct  83   KLKPKYISDGNVQVKFFDTGSAVGRGIEDSLTISNLTTSQQDIVLADELSQEVCILSADV 142
Query  143  VIGLGRPKSGRAAFNLPTVMENFVNQDNIANSFSFHHGRYPDGQHRGVLVLGGTIPAYYR 202
            V+G+  P    A +   TV+ENFV ++ IA  FS HH R+ DG+H G +++GG+   Y  
Sbjct  143  VVGIAAPGCPNA-LKGKTVLENFVEENLIAPVFSIHHARFQDGEHFGEIIFGGSDWKYVD 201
Query  203  GDFTYVPLVDKDTWNFKVDSISVGNEVVA-TDQLAFVDSSKYVITGPAEEIKKINDRLGC 261
            G+FTYVPLV  D+W F++D + +G+  VA     A +D+SK +I GP   +  IN+ +GC
Sbjct  202  GEFTYVPLVGDDSWKFRLDGVKIGDTTVAPAGTQAIIDTSKAIIVGPKAYVNPINEAIGC 261
Query  262  TNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTYHIQQNGDLCYSGFQYSAGKCF 321
              +   +R +C +DC K+ ++P VTF I G  FNISS Y+IQQNG+LCYSGFQ   G   
Sbjct  262  VVEKTTTRRICKLDCSKIPSLPDVTFVINGRNFNISSQYYIQQNGNLCYSGFQ-PCGHSD 320
Query  322  HF--GDFFMDNYYAKFDGQNKRMGFAKSVE 349
            HF  GDFF+D+YY++F+ +NK MGF +SVE
Sbjct  321  HFFIGDFFVDHYYSEFNWENKTMGFGRSVE 350

Sequence Alignment: 3. Allergen Name: Aed a 11.0101 Sequence ID: Q03168

 Score = 119.9 bits 498,  Expect = 2e-28
 Identities = 104/310 33%, Positives = 160/310 51%, Gaps = 26/310 8%
Query  32   PVEEYINTQYVGPVQLGN--QYFLCVFDTSSYTTVIPSASCVSGGCNCANVHKYYSNKPV 89
            P+  Y++ QY G + +G   Q F  VFDT S    +PS  C      C   +KY + K  
Sbjct  59   PLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSS 118
Query  90   S--NNVASVRI-LGSGYANGSEAHDYIAVSTLNATNQGFLLADDISNDICSLGA---DCV 143
            +   N  +  I  GSG  +G  + D + +  ++ T Q F  A+ I+     + A   D +
Sbjct  119  TFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTF--AEAINEPGLVFVAAKFDGI 176
Query  144  IGLGRPKSGRAAFNLPTVMENFVNQDNI-ANSFSFHHGRYPDGQHRGVLVLGGTIPAYYR 202
            +GLG   S  +   +  V  N  NQ  I A  FSF+  R P     G +++GG+    Y 
Sbjct  177  LGLGY--SSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYT 234
Query  203  GDFTYVPLVDKDTWNFKVDSISVGN-EVVATDQLAFVDSSKYVITGPAEEIKKINDRLGC 261
            GDFTY+ +  K  W FK+DS+ VG+ E       A  D+   +I GP  E+  IN  +G 
Sbjct  235  GDFTYLSVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGG 294
Query  262  TNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTYHI----QQNGDLCYSGFQY-- 315
            T  + G     + DC  +  +P ++F +GG +F++    ++    Q    +C SGF    
Sbjct  295  TPIMNGEY---MVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGID 351
Query  316  ---SAGKCFHFGDFFMDNYYAKFDGQNKRMGFAKSV 348
                 G  + +GD F+  YY +FD  N R+GFA +V
Sbjct  352  IPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFATAV 387

Sequence Alignment: 4. Allergen Name: Rhi o 1.0101 Sequence ID: I1CLC6

 Score = 100.1 bits 411,  Expect = 2e-22
 Identities = 90/308 29%, Positives = 148/308 48%, Gaps = 23/308 7%
Query  32   PVEEYINTQYVGPVQLGN--QYFLCVFDTSSYTTVIPSASCVSGGCNCANVHKYY---SN 86
            P+  Y+N QY G +++G   Q F  VFDT S    +PS  C S  C    +HK Y   S+
Sbjct  78   PLSNYLNAQYYGEIEIGTPPQPFTVVFDTGSSNLWVPSTHCTSIACF---LHKRYDSASS 134
Query  87   KPVSNNVASVRI-LGSGYANGSEAHDYIAVSTLNATNQGFLLADDISNDICSLGA-DCVI 144
            +  S N     I  G+G   G  ++D ++V  +   +QGF  +        ++   D + 
Sbjct  135  RTYSENGTEFAIQYGTGSLEGFISQDTLSVGGIQVEDQGFAESTKEPGLTFAFAKFDGIF 194
Query  145  GLGRPKSGRAAFNLPTVMENFVNQDNIANS-FSFH-HGRYPDGQHRGVLVLGGTIPAYYR 202
            GLG   +      +P    + VN+D +    FSF  +    D  + G L++GG    ++ 
Sbjct  195  GLGYD-TISVKHTIPPFY-HMVNRDLVDEPLFSFWLNDANKDQDNGGELIFGGVDEDHFE 252
Query  203  GDFTYVPLVDKDTWNFKVDSISVGNEVVATDQL-AFVDSSKYVITGPAEEIKKINDRLGC 261
            GD  +  +  K  W   +++I  G++ V  D + A +D+   ++  P      IN  LG 
Sbjct  253  GDIHWSDVRRKGYWEITMENIKFGDDYVDIDPVGAAIDTGSSLLVAPTTVAALINKELGA 312
Query  262  TNKVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTYHIQQNGDLCYSGFQ-----YS 316
                 G     V DC+K+ ++P   F   G  F +    ++ +    C SGF        
Sbjct  313  EKNWAGQY---VVDCNKVPSLPEFCFVFNGKDFCLEGKDYVLEVQGQCISGFMGMDIPEP 369
Query  317  AGKCFHFGDFFMDNYYAKFDGQNKRMGFAKS 347
            AG  +  GD F+  +Y+ +D  N R+G+A S
Sbjct  370  AGPLWIVGDVFLRKFYSVYDLGNNRVGLAPS 400

Sequence Alignment: 5. Allergen Name: Asp f 10 Sequence ID: CAA59419

 Score = 62.7 bits 247,  Expect = 3e-11
 Identities = 75/300 25%, Positives = 129/300 43%, Gaps = 24/300 8%
Query  35   EYINTQYVGPVQLGNQYFLCVFDTSSYTTVIPSASCVSGGCNCANVHKYYSNKPVSNNVA 94
            E  +++Y+ PV++G   +   FDT S    + S+   +   +   ++K  +N    N   
Sbjct  80   EQYDSEYLTPVKVGGTTLNLDFDTGSADLWVFSSELSASQSSGHAIYKPSANAQKLNGYT 139
Query  95   SVRILGSGY-ANGSEAHDYIAVSTLNATNQGFLLADDISND-ICSLGADCVIGLGRPK-- 150
                 G G  A+G    D + V  + A +Q    A  IS+  +     D ++GL      
Sbjct  140  WKIQYGDGSSASGDVYKDTVTVGGVTAQSQAVEAASHISSQFVQDKDNDGLLGLAFSSIN 199
Query  151  --SGRAAFNLPTVMENFVNQDNIANSFSFHHGRYPDGQHRGVLVLGGTIPAYYRGDFTYV 208
              S R    +   +++ ++    A ++ +H    P     G   +G    + ++G++TY 
Sbjct  200  TVSPRPQTTFFDTVKSQLDSPLFAVTLKYHA---P-----GTYDFGYIDNSKFQGELTYT 251
Query  209  PLVDKDT--WNFKVDSISVGNEVVATDQLAFVDSSKYVITGPAEEIKKINDRLGCTNKVI 266
              VD     W F  D   VGN    ++ ++ +  +   +    + +     R     K  
Sbjct  252  D-VDSSQGFWMFTADGYGVGNGAPNSNSISGIADTGTTLLLLDDSVVADYYRQVSGAKNS 310
Query  267  GSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTY----HIQQNGDLCYSGFQYSAGKCFH 322
                  VF C     +PS T  IGG    +   Y     +      CY G Q ++G  F 
Sbjct  311  NQYGGYVFPCST--KLPSFTTVIGGYNAVVPGEYINYAPVTDGSSTCYGGIQSNSGLGFS 368
Query  323  -FGDFFMDNYYAKFDGQNKRMGFA 345
             FGD F+ + Y  FD Q  R+GFA
Sbjct  369  IFGDIFLKSQYVVFDSQGPRLGFA 392

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.