The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTGRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIG
VAAQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETG
LGVIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQ
AQEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEF
VEIINAKA
Sequence Info Allergen Name Length Opt Bits Score E Value
XP_026795867 Pan h 8.0101 248 1617 375.3 1.1e-105
ACM09737 Sal s 8.01 247 1403 326.5 5.2e-91
QAT18637 Der p 25.0101 247 1190 277.9 2.1e-76
AIO08860 Der f 25.0201 247 1184 276.6 5.5e-76
A0A1L5YRA2 Scy p 8.0101 248 1173 274.1 3.2e-75
F5A6E97 Pro c 8.0101 248 1154 269.7 6.3e-74
L7UZA7 Der f 25.0101 247 1145 267.7 2.6e-73
Q8T5G9 Arc s 8.0101 224 1047 245.4 1.2e-66
CAC14917 Tri a TPIS 253 1041 244.0 3.7e-66
CAC14917 Tri a 31.0101 253 1041 244.0 3.7e-66
F8QN77 Pen m 8.0101 266 940 220.9 3.4e-59
Q0CJH1 Asp t 36.0101 249 899 211.6 2e-56
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pan h 8.0101 Sequence ID: XP_026795867

 Score = 375.3 bits 1617,  Expect = 1e-105
 Identities = 248/248 100%, Positives = 248/248 100%, Gaps = 0/248 0%
Query  1    MTGRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIG 60
            MTGRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIG
Sbjct  1    MTGRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIG 60
Query  61   VAAQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETG 120
            VAAQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETG
Sbjct  61   VAAQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETG 120
Query  121  LGVIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQ 180
            LGVIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQ
Sbjct  121  LGVIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQ 180
Query  181  AQEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEF 240
            AQEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEF
Sbjct  181  AQEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEF 240
Query  241  VEIINAKA 248
            VEIINAKA
Sbjct  241  VEIINAKA 248

Sequence Alignment: 2. Allergen Name: Sal s 8.01 Sequence ID: ACM09737

 Score = 326.5 bits 1403,  Expect = 5e-91
 Identities = 211/244 86%, Positives = 223/244 91%, Gaps = 0/244 0%
Query  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
            RKFFVGGNWKMNGDK SLGELI TLNSA L+ +TEVVCGAPSIYL+FARSKLD KIGVAA
Sbjct  3    RKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAA 62
Query  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
            QNCYKV  GAFTGEISPAMIKD GV WVILGHSERR VFGE+DELIGQK AHALE GLGV
Sbjct  63   QNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGV 122
Query  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
            IACIGEKLDEREAGITEKV+ AQTK  ADN+KDWSKVV+AYEPVWAIGTGKTASP QAQ+
Sbjct  123  IACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQD 182
Query  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
            VHDKLRQW+ AN+SEAVANSVRIIYGGSVTG TCKEL   KDVDGFLVGGA+LKPEFV+I
Sbjct  183  VHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFVDI 242
Query  244  INAK 247
            INAK
Sbjct  243  INAK 246

Sequence Alignment: 3. Allergen Name: Der p 25.0101 Sequence ID: QAT18637

 Score = 277.9 bits 1190,  Expect = 2e-76
 Identities = 178/245 72%, Positives = 204/245 83%, Gaps = 0/245 0%
Query  3    GRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVA 62
            GRKFFVGGNWKMNG + +  +LI  L +  L+ +TEVV G PSIYL   R KL   IGVA
Sbjct  2    GRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVA 61
Query  63   AQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLG 122
            AQNCYKVAKGAFTGEISPAMIKD G EWVILGHSERR+VFGE+D+LIG+KV HAL  GL 
Sbjct  62   AQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLN 121
Query  123  VIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQ 182
            VIACIGE ++EREAG T +VVF QT+ I+ +VKDWSKVV+AYEPVWAIGTGKTASPQQAQ
Sbjct  122  VIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQ 181
Query  183  EVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVE 242
            EVH +LRQW S NIS  +A ++RIIYGGSVT +  KELA+Q DVDGFLVGGASLKPEFV+
Sbjct  182  EVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFVQ 241
Query  243  IINAK 247
            I+NA+
Sbjct  242  IVNAR 246

Sequence Alignment: 4. Allergen Name: Der f 25.0201 Sequence ID: AIO08860

 Score = 276.6 bits 1184,  Expect = 6e-76
 Identities = 177/244 72%, Positives = 204/244 83%, Gaps = 0/244 0%
Query  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
            RKFFVGGNWKMNG + +  +LI TL++  L+ +T+VV G PSIY+   R KL   IGVAA
Sbjct  3    RKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAA 62
Query  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
            QNCYKV KGAFTGEISPAMIKD G EWVILGHSERR+VFGESD+LIG+KV HAL+ GL V
Sbjct  63   QNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
Query  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
            IACIGE L+EREAG T +VVF QT+ I+ +VKDWSKVV+AYEPVWAIGTGKTASPQQAQE
Sbjct  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
Query  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
            VH KLRQW S N+S  +A ++RIIYGGSVT    KELA+Q DVDGFLVGGASLKPEFV+I
Sbjct  183  VHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
Query  244  INAK 247
            +NA+
Sbjct  243  VNAR 246

Sequence Alignment: 5. Allergen Name: Scy p 8.0101 Sequence ID: A0A1L5YRA2

 Score = 274.1 bits 1173,  Expect = 3e-75
 Identities = 173/244 70%, Positives = 199/244 81%, Gaps = 1/244 0%
Query  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
            RKFFVGGNWKMNGDK ++  +I+ +    LNADTEVV G P  YL + R  + A IGVAA
Sbjct  5    RKFFVGGNWKMNGDKAAIDGIISFMKGP-LNADTEVVVGCPQCYLMYTREHMPANIGVAA 63
Query  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
            QNCYK AKGAFTGEISPAMIKDCG EWVILGHSERR+VFGE D+LI +KV HALE GL V
Sbjct  64   QNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVFGEPDQLISEKVGHALEAGLKV 123
Query  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
            I CIGEKL+ERE+  TE+VVFAQ KA+  N+ DWS+VV+AYEPVWAIGTGKTA+P+QAQ+
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQD 183
Query  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
            VH KLRQW+  N+S  VA S RIIYGGSV+   CKELA   D+DGFLVGGASLKP+FV I
Sbjct  184  VHAKLRQWLRDNVSPQVAESTRIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPDFVTI 243
Query  244  INAKA 248
            INA+A
Sbjct  244  INARA 248

Sequence Alignment: 6. Allergen Name: Pro c 8.0101 Sequence ID: F5A6E97

 Score = 269.7 bits 1154,  Expect = 6e-74
 Identities = 170/243 69%, Positives = 198/243 81%, Gaps = 1/243 0%
Query  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
            RKFFVGGNWKMNGD+  +  +I+ +    L+ADTEVV G P  YL + R  L + IGVAA
Sbjct  5    RKFFVGGNWKMNGDRAGIDSIISFMKGP-LSADTEVVVGCPQCYLMYTREHLPSNIGVAA 63
Query  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
            QNCYKVAKGAFTGEISP+MIKDCG EWVILGHSERR+VF E D LI +KV HALE GL V
Sbjct  64   QNCYKVAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKV 123
Query  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
            I CIGEKL+ERE+  TE+VVFAQ KA+  N+ DWS+VV+AYEPVWAIGTGKTA+P+QAQE
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQE 183
Query  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
            VH KLRQW+  N++  VA+S RIIYGGSVT   CKELA   D+DGFLVGGASLKP+FV+I
Sbjct  184  VHAKLRQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGGASLKPDFVQI 243
Query  244  INAK 247
            INA+
Sbjct  244  INAR 247

Sequence Alignment: 7. Allergen Name: Der f 25.0101 Sequence ID: L7UZA7

 Score = 267.7 bits 1145,  Expect = 3e-73
 Identities = 172/245 70%, Positives = 204/245 83%, Gaps = 0/245 0%
Query  3    GRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVA 62
            GRKFFVGGNWKMNG+K ++ E+++ L +  L+++ EVV G P+IYL + ++ L   I VA
Sbjct  2    GRKFFVGGNWKMNGNKTAIKEIVDFLKNGPLDSNVEVVVGVPAIYLMLCKNILPDNIRVA 61
Query  63   AQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLG 122
            AQNCYKV KGAFTGEISPAMIKD G EWVILGHSERR+VFGESD+LIG+KV HAL+ GL 
Sbjct  62   AQNCYKVDKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLH 121
Query  123  VIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQ 182
            VIACIGE L+EREAG T +VVF QT+ I+ +VKDW KVV+AYEPVWAIGTGKTASPQQAQ
Sbjct  122  VIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWFKVVLAYEPVWAIGTGKTASPQQAQ 181
Query  183  EVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVE 242
            EVH KLRQ  S N+S  +A ++RIIYGGSVT    KELA+Q DVDGFLVGGASLKPEFV+
Sbjct  182  EVHQKLRQCFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQ 241
Query  243  IINAK 247
            I+NA+
Sbjct  242  IVNAR 246

Sequence Alignment: 8. Allergen Name: Arc s 8.0101 Sequence ID: Q8T5G9

 Score = 245.4 bits 1047,  Expect = 1e-66
 Identities = 154/224 68%, Positives = 179/224 79%, Gaps = 1/224 0%
Query  9    GGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAAQNCYK 68
            GGNWKMNGD+ S+  +I+ +    L+ DTEVV G P  YL + R  L + IGVAAQNCYK
Sbjct  1    GGNWKMNGDRASIDSIISFMKGP-LSGDTEVVVGCPQCYLMYTREHLPSNIGVAAQNCYK 59
Query  69   VAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGVIACIG 128
            VAKGAFTGEISP+MIKDCG EWVILGHSERR+VF E D LI +KV HALE GL VI CIG
Sbjct  60   VAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKVIPCIG 119
Query  129  EKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQEVHDKL 188
            EKL+ERE+  TE+VVFAQ KA+  N+ DWS+VV+AYEPVWAIGTGKTA+P+QAQEVH KL
Sbjct  120  EKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQEVHAKL 179
Query  189  RQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGG 233
            RQW+  N++  VA+S RIIYGGSVT   CKELA   D+DGFLVGG
Sbjct  180  RQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGG 224

Sequence Alignment: 9. Allergen Name: Tri a TPIS Sequence ID: CAC14917

 Score = 244.0 bits 1041,  Expect = 4e-66
 Identities = 158/246 64%, Positives = 188/246 76%, Gaps = 2/246 0%
Query  3    GRKFFVGGNWKMNGDKKSLGELINTLNSATLNAD--TEVVCGAPSIYLDFARSKLDAKIG 60
            GRKFFVGGNWK NG  + +  ++NTLN+  + +    EVV   P ++L   + KL  +I 
Sbjct  2    GRKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQ 61
Query  61   VAAQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETG 120
            VAAQNC+    GAFTGE+S  M+ + GV WVILGHSERR + GES E++G+KVA+AL  G
Sbjct  62   VAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQG 121
Query  121  LGVIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQ 180
            L VIAC+GE L++REAG T  VV  QTKAIAD +KDW+ VVVAYEPVWAIGTGK ASP Q
Sbjct  122  LKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPAQ 181
Query  181  AQEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEF 240
            AQEVH  LR W+  N+S  VA S RIIYGGSVTGA+CKELAAQ DVDGFLVGGASLKPEF
Sbjct  182  AQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPEF 241
Query  241  VEIINAKA 248
            ++IINA A
Sbjct  242  IDIINAAA 249

Sequence Alignment: 10. Allergen Name: Tri a 31.0101 Sequence ID: CAC14917

 Score = 244.0 bits 1041,  Expect = 4e-66
 Identities = 158/246 64%, Positives = 188/246 76%, Gaps = 2/246 0%
Query  3    GRKFFVGGNWKMNGDKKSLGELINTLNSATLNAD--TEVVCGAPSIYLDFARSKLDAKIG 60
            GRKFFVGGNWK NG  + +  ++NTLN+  + +    EVV   P ++L   + KL  +I 
Sbjct  2    GRKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQ 61
Query  61   VAAQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETG 120
            VAAQNC+    GAFTGE+S  M+ + GV WVILGHSERR + GES E++G+KVA+AL  G
Sbjct  62   VAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQG 121
Query  121  LGVIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQ 180
            L VIAC+GE L++REAG T  VV  QTKAIAD +KDW+ VVVAYEPVWAIGTGK ASP Q
Sbjct  122  LKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPAQ 181
Query  181  AQEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEF 240
            AQEVH  LR W+  N+S  VA S RIIYGGSVTGA+CKELAAQ DVDGFLVGGASLKPEF
Sbjct  182  AQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPEF 241
Query  241  VEIINAKA 248
            ++IINA A
Sbjct  242  IDIINAAA 249

Sequence Alignment: 11. Allergen Name: Pen m 8.0101 Sequence ID: F8QN77

 Score = 220.9 bits 940,  Expect = 3e-59
 Identities = 132/244 54%, Positives = 180/244 73%, Gaps = 0/244 0%
Query  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
            RKFFV GNWKMN DK  +  ++  +N+A L+A+TE V G PS YL +AR  L   IG+AA
Sbjct  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
Query  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
            QNCYKVA+G F+GEISP MIKDCG +WVILGH ERR VF E D +I +KVAHA E G+ +
Sbjct  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
Query  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
            IAC+ E  D+R+ G TE+V+F Q  ++A  + DWS+VV+A+E +WA  TG  A+ QQ Q+
Sbjct  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
Query  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
                +R W+  N+S+ VA++ R+IY GSV+   C+E+A+ +++DGFLVGGASLKP+ V+I
Sbjct  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
Query  244  INAK 247
            IN++
Sbjct  245  INSR 248

Sequence Alignment: 12. Allergen Name: Asp t 36.0101 Sequence ID: Q0CJH1

 Score = 211.6 bits 899,  Expect = 2e-56
 Identities = 136/244 55%, Positives = 181/244 74%, Gaps = 2/244 0%
Query  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
            R+FFVGGN+KMNG   S+  +I  LN A L++ +EVV   P++YL +AR   ++ IGVAA
Sbjct  3    RQFFVGGNFKMNGTADSITSIIKNLNDAKLDSSSEVVISPPALYLLLAREVANSNIGVAA 62
Query  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
            QN +    GAFTGEIS   ++D  ++W ++GHSERR ++ ESDE+I +KV  A++ G+ V
Sbjct  63   QNVFDKPNGAFTGEISVEQLRDAKIDWTLIGHSERRVILKESDEFIARKVKAAIDGGVSV 122
Query  124  IACIGEKLDEREAGITEKVVFAQTKAIADNV--KDWSKVVVAYEPVWAIGTGKTASPQQA 181
            I CIGE L+EREAG T  VV  Q  A+A  +  + W+KVV+AYEPVWAIGTGK A+ +QA
Sbjct  123  IFCIGETLEEREAGKTIDVVTRQLNAVAKELSKEQWAKVVIAYEPVWAIGTGKVATTEQA 182
Query  182  QEVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFV 241
            QEVH  +R+W++  IS  V+++ RIIYGGSV+   C+ELA Q DVDGFLVGGASLKP FV
Sbjct  183  QEVHAAIRKWLTETISPEVSDNTRIIYGGSVSEKNCRELAKQPDVDGFLVGGASLKPAFV 242
Query  242  EIINAK 247
            +IINA+
Sbjct  243  DIINAR 248

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.