The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN
GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEYYYPIYFA
KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN
VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK
Sequence Info Allergen Name Length Opt Bits Score E Value
AUW37958 Per a 5.0101 216 1445 336.2 4.8e-94
AEV23867 Per a 5.0102 216 1435 333.9 2.3e-93
AGC56215 Der f 8.0101 197 134 37.4 0.00038
P46436 Asc s 13.0101 206 134 37.4 0.00041
P46436 Asc l 13.0101w 206 134 37.4 0.00041
AHF71027 Bet v 8.0101 237 133 37.1 0.00057
Q6R4B4 Alt a 13.0101 231 126 35.5 0.0017
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 5.0101 Sequence ID: AUW37958

 Score = 336.2 bits 1445,  Expect = 5e-94
 Identities = 216/216 100%, Positives = 216/216 100%, Gaps = 0/216 0%
Query  1    MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN 60
            MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN
Sbjct  1    MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN 60
Query  61   GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEYYYPIYFA 120
            GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEYYYPIYFA
Sbjct  61   GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEYYYPIYFA 120
Query  121  KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN 180
            KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN
Sbjct  121  KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN 180
Query  181  VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK 216
            VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK
Sbjct  181  VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK 216

Sequence Alignment: 2. Allergen Name: Per a 5.0102 Sequence ID: AEV23867

 Score = 333.9 bits 1435,  Expect = 2e-93
 Identities = 215/216 99%, Positives = 215/216 99%, Gaps = 0/216 0%
Query  1    MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN 60
            MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN
Sbjct  1    MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN 60
Query  61   GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEYYYPIYFA 120
            GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDI TLYHRFGEYYYPIYFA
Sbjct  61   GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIGTLYHRFGEYYYPIYFA 120
Query  121  KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN 180
            KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN
Sbjct  121  KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN 180
Query  181  VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK 216
            VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK
Sbjct  181  VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK 216

Sequence Alignment: 3. Allergen Name: Der f 8.0101 Sequence ID: AGC56215

 Score = 37.4 bits 134,  Expect = 0.0004
 Identities = 31/131 23%, Positives = 74/131 56%, Gaps = 8/131 6%
Query  54   IPTLNDNGFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEY 113
            +P   D    + +S AIL YLA +Y  D +   ++  + ++ +Q+ + D+     R    
Sbjct  39   LPYYMDGDVKITQSMAILRYLARKYNMDGT-NEQERLRISMAEQQTH-DMFMAMVRIC-- 94
Query  114  YYPIYFAKQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGF 173
            Y P     +    + +K L ++++++ KFL +++++AG+K++ AD+ +   +    +M  
Sbjct  95   YDPNM---ENLRVDYLKTLPDSLKLMEKFLANHDYIAGSKISYADFYLYEYLCRMKVMVP 151
Query  174  DV-SKYSNVAKWFEKCKKI 191
            +V  ++ N+ K+ E+ + +
Sbjct  152  EVYGQFENLKKFVERIESL 170

Sequence Alignment: 4. Allergen Name: Asc s 13.0101 Sequence ID: P46436

 Score = 37.4 bits 134,  Expect = 0.0004
 Identities = 39/147 26%, Positives = 71/147 48%, Gaps = 7/147 4%
Query  43   PEFLKMNPQHTIPTLNDNGFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYF- 101
            P +    P   +P L  +G  L +S AI  YL  Q+G       ++A+  ++ DQ   F 
Sbjct  40   PALKPKTPFGQLPLLEVDGEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFM 99
Query  102  -DIRTLYHRFG--EYYYPIYFAKQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIAD 158
             ++R  +  +   E        K+ A P + K L    +FL K     E++ G  +T AD
Sbjct  100  AELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAK--SGSEYMVGKSVTWAD 157
Query  159  LAIVSSVSTADIMGFD-VSKYSNVAKWFEKCKKI 191
            L I  S+++ + +  D +S +  + K+ E  +++
Sbjct  158  LVITDSLASWESLIPDFLSGHLQLKKYIEHVREL 191

Sequence Alignment: 5. Allergen Name: Asc l 13.0101w Sequence ID: P46436

 Score = 37.4 bits 134,  Expect = 0.0004
 Identities = 39/147 26%, Positives = 71/147 48%, Gaps = 7/147 4%
Query  43   PEFLKMNPQHTIPTLNDNGFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYF- 101
            P +    P   +P L  +G  L +S AI  YL  Q+G       ++A+  ++ DQ   F 
Sbjct  40   PALKPKTPFGQLPLLEVDGEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFM 99
Query  102  -DIRTLYHRFG--EYYYPIYFAKQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIAD 158
             ++R  +  +   E        K+ A P + K L    +FL K     E++ G  +T AD
Sbjct  100  AELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAK--SGSEYMVGKSVTWAD 157
Query  159  LAIVSSVSTADIMGFD-VSKYSNVAKWFEKCKKI 191
            L I  S+++ + +  D +S +  + K+ E  +++
Sbjct  158  LVITDSLASWESLIPDFLSGHLQLKKYIEHVREL 191

Sequence Alignment: 6. Allergen Name: Bet v 8.0101 Sequence ID: AHF71027

 Score = 37.1 bits 133,  Expect = 0.0006
 Identities = 44/131 33%, Positives = 75/131 57%, Gaps = 24/131 18%
Query  47   KMNPQHTIPTLNDNGFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRL-YFDI-- 103
            K+ P++ +P L  NG  + ES  ++ Y+ D   +  SL P D  K+A+ ++ + Y D   
Sbjct  72   KVYPENKVPALEHNGKVIGESLDLIKYV-DINFEGPSLLPNDPAKKAFAEELVAYSDTFN 130
Query  104  RTLYHRF-GEYYYPIYFAKQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIV 162
            +T++  F G+   P+  A  A D      LE+A   L+KF +   F+   +++  D+  +
Sbjct  131  KTVFTSFKGD---PVKEAGPAFD-----HLEKA---LHKFDDGPFFL--GQFSAVDIVYI 177
Query  163  SSVSTADIMGFDVSKYS------NVAKWFEKCKKI 191
              V    I  +D  KY        +AKW E+  KI
Sbjct  178  PFVERFQIFLLDALKYDITAGRPKLAKWIEELNKI 212

Sequence Alignment: 7. Allergen Name: Alt a 13.0101 Sequence ID: Q6R4B4

 Score = 35.5 bits 126,  Expect = 0.002
 Identities = 27/108 25%, Positives = 61/108 56%, Gaps = 11/108 10%
Query  43   PEFLKMNPQHTIPTL---NDNG---FCLWESRAILSYLADQYGKDDSLYPKDAKKRALVD 96
            P F ++NP+  +P +   + +G   +  WES + L Y+AD Y KD ++  ++ ++ + ++
Sbjct  53   PWFTEINPHRMVPVILEKSPDGRDTLRAWESTSTLMYIADAYDKDGTFGGRNVQESSDIN 112
Query  97   QRLYFDIRTL--YHRFGEYYYPIYFAKQAADPEKMKK-LEEAFEFLNKFLE--SQEFVA 150
              L +    L    ++  Y+Y ++  K     EK++  +   ++ L + L    Q+++A
Sbjct  113  NWLTLHTAALGPTAKYWLYFYKLHPEKLPKTIEKLRSNITVQYDILERRLNEPGQQYLA 171

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.