The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTRFSLTVLAVLAACFGSNIRPNVATLEPKTVCYYESWVHWRQGEGKMDPEDIDTSLCTH
IVYSYFGIDAATHEIKLLDEYLMKDLHDMEHFTQHKGNAKAMIAVGGSTMSDQFSKTAAV
EHYRETFVVSTVDLMTRYGFDGVMIDWSGMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTL
PATIASYDNYNIPAISNYVDFMNVLSLDYTGSWAHTVGHASPFPEQLKTLEAYHKRGAPR
HKMVMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAF
TITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGV
CGDKNPLLHAIQSNYYHGVVTEPTVVTLPPVTHTTEHVTDIPGVFHCHEEGFFRDKTYCA
TYYECKKGDFGLEKTVHHCANHLQAFDEVSRTCIDHTKIPGC
Sequence Info Allergen Name Length Opt Bits Score E Value
AAM19082 Der f 18.0101 462 3170 728.9 1.3e-211
Q4JK71 Der p 18.0101 462 2895 666.2 9.9e-193
AAD52672 Der f 15.0101 555 329 81.2 1.5e-16
Q4JK69 Der p 15.0101 532 319 79.0 6.7e-16
Q4JK70 Der p 15.0102 558 319 79.0 7.1e-16
AII81930 Bla g 12.0101 539 277 69.4 5.2e-13
AKH04311 Per a 12.0101 407 255 64.4 1.2e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 18.0101 Sequence ID: AAM19082

 Score = 728.9 bits 3170,  Expect = 1e-211
 Identities = 462/462 100%, Positives = 462/462 100%, Gaps = 0/462 0%
Query  1    MTRFSLTVLAVLAACFGSNIRPNVATLEPKTVCYYESWVHWRQGEGKMDPEDIDTSLCTH 60
            MTRFSLTVLAVLAACFGSNIRPNVATLEPKTVCYYESWVHWRQGEGKMDPEDIDTSLCTH
Sbjct  1    MTRFSLTVLAVLAACFGSNIRPNVATLEPKTVCYYESWVHWRQGEGKMDPEDIDTSLCTH 60
Query  61   IVYSYFGIDAATHEIKLLDEYLMKDLHDMEHFTQHKGNAKAMIAVGGSTMSDQFSKTAAV 120
            IVYSYFGIDAATHEIKLLDEYLMKDLHDMEHFTQHKGNAKAMIAVGGSTMSDQFSKTAAV
Sbjct  61   IVYSYFGIDAATHEIKLLDEYLMKDLHDMEHFTQHKGNAKAMIAVGGSTMSDQFSKTAAV 120
Query  121  EHYRETFVVSTVDLMTRYGFDGVMIDWSGMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTL 180
            EHYRETFVVSTVDLMTRYGFDGVMIDWSGMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTL
Sbjct  121  EHYRETFVVSTVDLMTRYGFDGVMIDWSGMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTL 180
Query  181  PATIASYDNYNIPAISNYVDFMNVLSLDYTGSWAHTVGHASPFPEQLKTLEAYHKRGAPR 240
            PATIASYDNYNIPAISNYVDFMNVLSLDYTGSWAHTVGHASPFPEQLKTLEAYHKRGAPR
Sbjct  181  PATIASYDNYNIPAISNYVDFMNVLSLDYTGSWAHTVGHASPFPEQLKTLEAYHKRGAPR 240
Query  241  HKMVMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAF 300
            HKMVMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAF
Sbjct  241  HKMVMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAF 300
Query  301  TITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGV 360
            TITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGV
Sbjct  301  TITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGV 360
Query  361  CGDKNPLLHAIQSNYYHGVVTEPTVVTLPPVTHTTEHVTDIPGVFHCHEEGFFRDKTYCA 420
            CGDKNPLLHAIQSNYYHGVVTEPTVVTLPPVTHTTEHVTDIPGVFHCHEEGFFRDKTYCA
Sbjct  361  CGDKNPLLHAIQSNYYHGVVTEPTVVTLPPVTHTTEHVTDIPGVFHCHEEGFFRDKTYCA 420
Query  421  TYYECKKGDFGLEKTVHHCANHLQAFDEVSRTCIDHTKIPGC 462
            TYYECKKGDFGLEKTVHHCANHLQAFDEVSRTCIDHTKIPGC
Sbjct  421  TYYECKKGDFGLEKTVHHCANHLQAFDEVSRTCIDHTKIPGC 462

Sequence Alignment: 2. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 666.2 bits 2895,  Expect = 1e-192
 Identities = 411/462 88%, Positives = 444/462 96%, Gaps = 0/462 0%
Query  1    MTRFSLTVLAVLAACFGSNIRPNVATLEPKTVCYYESWVHWRQGEGKMDPEDIDTSLCTH 60
            MTR+S+TVL  LAA FGSNIRPNVATL+PKTVCYYESWVHWRQG+GKMDPEDIDTSLC+H
Sbjct  1    MTRLSFTVLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSH 60
Query  61   IVYSYFGIDAATHEIKLLDEYLMKDLHDMEHFTQHKGNAKAMIAVGGSTMSDQFSKTAAV 120
            IVYSYFGIDA++HEIKLLD+YLM  LHDMEHFT+HKGNAKAMIAVGG++MSDQFSKTAAV
Sbjct  61   IVYSYFGIDASSHEIKLLDQYLMITLHDMEHFTKHKGNAKAMIAVGGASMSDQFSKTAAV 120
Query  121  EHYRETFVVSTVDLMTRYGFDGVMIDWSGMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTL 180
            EHYRETFVVST+DLMT+YGFDGVMIDWSGMQAKDSDNF+KLLDKFDEKFA+TSFVMGVTL
Sbjct  121  EHYRETFVVSTIDLMTKYGFDGVMIDWSGMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTL 180
Query  181  PATIASYDNYNIPAISNYVDFMNVLSLDYTGSWAHTVGHASPFPEQLKTLEAYHKRGAPR 240
            PATIASYDNYNIPAISNYVDFMNVL+LDY G WA+TVGHAS +PEQLKTLEAY+KRGAPR
Sbjct  181  PATIASYDNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASALPEQLKTLEAYNKRGAPR 240
Query  241  HKMVMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAF 300
            HKMVMAVPF+ARTWILEKM+KQD+GDKASGPGP+GQFTQT GFLSYNELCVQIQAETNAF
Sbjct  241  HKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAF 300
Query  301  TITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGV 360
            +ITRDHDNTAIYAVYVH NHAEWISFEDRHTLG+KA+NIT+QGY GMSVYTLSNEDVHGV
Sbjct  301  SITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGV 360
Query  361  CGDKNPLLHAIQSNYYHGVVTEPTVVTLPPVTHTTEHVTDIPGVFHCHEEGFFRDKTYCA 420
            CGDKNPLLHAI SNY+ G+VTEPTVVT+ PVTHTTEHVTDIPGVFHCH+EGFFRDKTYCA
Sbjct  361  CGDKNPLLHAINSNYFRGIVTEPTVVTVTPVTHTTEHVTDIPGVFHCHQEGFFRDKTYCA 420
Query  421  TYYECKKGDFGLEKTVHHCANHLQAFDEVSRTCIDHTKIPGC 462
             YYECKKGDFGLE+TVHHC NH QAFDEVSRTC+DH KIPGC
Sbjct  421  KYYECKKGDFGLEQTVHHCPNHSQAFDEVSRTCVDHAKIPGC 462

Sequence Alignment: 3. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 81.2 bits 329,  Expect = 1e-16
 Identities = 136/385 35%, Positives = 216/385 56%, Gaps = 62/385 16%
Query  7    TVLAVLA--ACFG---SNIR--PNVATLEP-KTVCYYESWVHWRQGEGKMDP---EDIDT 55
            T+ A+L+  AC G   ++I+   N  +  P + VCY  +W  +     K+DP   EDID 
Sbjct  3    TIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYH----KVDPYTIEDIDP 58
Query  56   SLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHD------MEHFTQHK-GNAK--AMIAVG 106
              CTH++Y +  ID   + I+++D Y   D H+       E F   +  N +   MI++G
Sbjct  59   FKCTHLMYGFAKIDEYKYTIQVFDPY-QDDNHNSWEKRGYERFNNLRLKNPELTTMISLG 117
Query  107  G-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDWS------GMQAKDSDNFI 159
            G    S+++S  AA   YR+ F+ S +D++  Y FDG+ +DW       G    D  N++
Sbjct  118  GWYEGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL 177
Query  160  KLLDKFDEKFAHTSFVMGVTLPATIASYDN-YNIPAISNYVDFMNVLSLDYTGSWAHTVG 218
             L+ ++ + F    +++   +       D  Y+I  ++   D+MNV++ DY G W +  G
Sbjct  178  ALVRELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYG 237
Query  219  HASPF---PEQLKTLEAY-------H---KRGAPRHKMVMAVPFYARTWILEKMNKQDIG 265
            H +P+   P++   L  Y       H     GA R K+VM VPFY R W +E  +K  +G
Sbjct  238  HNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLG 297
Query  266  DKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTITRDHDNTAIYAVYVHSNHAEWIS 325
            D A G  P G  +  +G LSY ELC   Q E   + I  D    A Y      N   W+ 
Sbjct  298  DPAKGMSPPGFISGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIWVG 351
Query  326  FEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGDKNPLLHAIQS-------NYYHG 378
            ++D  ++  K   + + G +G+ V++L N+D  G CG KNPLL+ +++       N +  
Sbjct  352  YDDLASISCKLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFEC 411
Query  379  VVTEPTVVTLP---PVTHTTEHVTDIP 402
            ++   T    P   P T TT   T  P
Sbjct  412  ILGPSTTTPTPTTTPTTPTTTPTTPSP 438

Sequence Alignment: 4. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 79.0 bits 319,  Expect = 7e-16
 Identities = 133/384 34%, Positives = 212/384 55%, Gaps = 59/384 15%
Query  3    RFSLTVLAVLAACFG---SNIR--PNVATLEP-KTVCYYESWVHWRQGEGKMDP---EDI 53
            + S  +L +L ACFG   + ++   N  +  P + VCY  +W  +     K+DP   EDI
Sbjct  2    KTSCAIL-ILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYH----KVDPYTIEDI 56
Query  54   DTSLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHDM--EHFTQHKGNAK-------AMIA 104
            D   CTH++Y +  ID   + I+++D Y   D H+   +H  +   N +        MI+
Sbjct  57   DPFKCTHLMYGFAKIDEYKYTIQVFDPY-QDDNHNTWEKHGYERFNNLRLKNPELTTMIS 115
Query  105  VGG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDWS------GMQAKDSDN 157
            +GG    S+++S   A   YR+ FV S +D++  Y FDG+ +DW       G    D  N
Sbjct  116  LGGWYEGSEKYSDMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQN 175
Query  158  FIKLLDKFDEKFAHTSFVMGVTLPATIASYD-NYNIPAISNYVDFMNVLSLDYTGSWAHT 216
            ++ L+ ++ E F    +++   +       D  Y +  ++   D+MNV++ DY G W + 
Sbjct  176  YLTLVRELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENV 235
Query  217  VGHASPF---PEQLKTLEAY-------H---KRGAPRHKMVMAVPFYARTWILEKMNKQD 263
             GH +P+   P++   L  Y       H     GA R K+VM VPFY R W +E  +K  
Sbjct  236  FGHNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVK 295
Query  264  IGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTITRDHDNTAIYAVYVHSNHAEW 323
            +GD A G  P G  T  +G LSY ELC   Q E   + I  D    A Y      N   W
Sbjct  296  LGDPAKGMSPPGFITGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIW 349
Query  324  ISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGDKNPLLHAIQSNYYHG----- 378
            + ++D  ++  K   + + G +G+ +++L N+D  G CG K PLL+ ++ N  +G     
Sbjct  350  VGYDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVH-NMINGDEKNS 408
Query  379  --VVTEPTVVTLPPVTHTTEHVT 399
               +  P+  T  P T +T   T
Sbjct  409  YECLLGPSTTTPTPTTPSTPSTT 431

Sequence Alignment: 5. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 79.0 bits 319,  Expect = 7e-16
 Identities = 133/384 34%, Positives = 212/384 55%, Gaps = 59/384 15%
Query  3    RFSLTVLAVLAACFG---SNIR--PNVATLEP-KTVCYYESWVHWRQGEGKMDP---EDI 53
            + S  +L +L ACFG   + ++   N  +  P + VCY  +W  +     K+DP   EDI
Sbjct  2    KTSCAIL-ILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYH----KVDPYTIEDI 56
Query  54   DTSLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHDM--EHFTQHKGNAK-------AMIA 104
            D   CTH++Y +  ID   + I+++D Y   D H+   +H  +   N +        MI+
Sbjct  57   DPFKCTHLMYGFAKIDEYKYTIQVFDPY-QDDNHNTWEKHGYERFNNLRLKNPELTTMIS 115
Query  105  VGG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDWS------GMQAKDSDN 157
            +GG    S+++S   A   YR+ FV S +D++  Y FDG+ +DW       G    D  N
Sbjct  116  LGGWYEGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQN 175
Query  158  FIKLLDKFDEKFAHTSFVMGVTLPATIASYD-NYNIPAISNYVDFMNVLSLDYTGSWAHT 216
            ++ L+ ++ E F    +++   +       D  Y +  ++   D+MNV++ DY G W + 
Sbjct  176  YLTLVRELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENV 235
Query  217  VGHASPF---PEQLKTLEAY-------H---KRGAPRHKMVMAVPFYARTWILEKMNKQD 263
             GH +P+   P++   L  Y       H     GA R K+VM VPFY R W +E  +K  
Sbjct  236  FGHNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVK 295
Query  264  IGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTITRDHDNTAIYAVYVHSNHAEW 323
            +GD A G  P G  T  +G LSY ELC   Q E   + I  D    A Y      N   W
Sbjct  296  LGDPAKGMSPPGFITGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIW 349
Query  324  ISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGDKNPLLHAIQSNYYHG----- 378
            + ++D  ++  K   + + G +G+ +++L N+D  G CG K PLL+ ++ N  +G     
Sbjct  350  VGYDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVH-NMINGDEKNS 408
Query  379  --VVTEPTVVTLPPVTHTTEHVT 399
               +  P+  T  P T +T   T
Sbjct  409  YECLLGPSTTTPTPTTPSTPSTT 431

Sequence Alignment: 6. Allergen Name: Bla g 12.0101 Sequence ID: AII81930

 Score = 69.4 bits 277,  Expect = 5e-13
 Identities = 111/357 31%, Positives = 191/357 53%, Gaps = 31/357 8%
Query  30   KTVCYYESWVHWRQGEGKMDPEDIDTSLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHDM 89
            + VCY+ +W  +R G G    EDI T LCTH++YS+ G+   T    +LD+    DL   
Sbjct  28   RVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIGVSNVTWGPLILDQENDVDLRGF 87
Query  90   EHFTQHKGNA-KAMIAVGG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDW 147
             +FT  K    K  +A+GG      ++S   + +  R+TF+ + V+++ +Y FDG+ IDW
Sbjct  88   LNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSDKKLRDTFIPALVEFLHKYNFDGLDIDW 147
Query  148  S-------GMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTLPATIASY---DNYNIPAISN 197
                    G    D  NF  +++++   F        +T+   +A++   + Y++P +  
Sbjct  148  EYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWEITMAVPLANFRLNEGYHVPDLCE 207
Query  198  YVDFMNVLSLDYTGSWAHTVGHASPF---PEQLKTLEAYHK---------RGAPRHKMVM 245
             +D ++V++ D  G+WA      SP+   P +    +A +          +G    K+V+
Sbjct  208  LIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEGYGYQALNDNDGMQLWVDKGCSPDKLVL 267
Query  246  AVPFYARTWILEKMN-KQDIG---DKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFT 301
              PFY RT+ L + N  +DIG   +K +G G  G +T   G L+Y E+C  +Q   NA  
Sbjct  268  GTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYTGAKGMLAYYEICNMLQ--VNASK 325
Query  302  ITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVC 361
             T+  D+      Y + +  +W+ +++  +L  K   I ++GY G   + +  +D HG C
Sbjct  326  WTQKFDDIG-KCPYAYDDGNQWVGYDNEISLQYKMDFIKEKGYLGAMTWAIDMDDFHGTC 384
Query  362  GDKNPLLHAIQSNYYHGVVTEPTVVTLP 389
            G KNPL++ +  N    VV    + T P
Sbjct  385  GQKNPLINVLAKNMKDYVVPTLQISTTP 412

Sequence Alignment: 7. Allergen Name: Per a 12.0101 Sequence ID: AKH04311

 Score = 64.4 bits 255,  Expect = 1e-11
 Identities = 121/325 37%, Positives = 200/325 61%, Gaps = 44/325 13%
Query  33   CYYESWVHWRQGEGKMDPEDIDTSLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHD---- 88
            CYY SW  +R G    + ++IDT LCTHIVY++ G+      I  LDEY   D  +    
Sbjct  46   CYYGSWATYRWGIATFEVDNIDTRLCTHIVYAFTGLRDGV--IVSLDEY--NDYEENWGK 101
Query  89   --MEHFTQ-HKGNA-KAMIAVGG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGV 143
              M+ FT   K N  KA++ +GG +  S ++S+ AA +  RETF  S V ++ + GFDG+
Sbjct  102  GLMKKFTTLAKNNGIKALVGLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGL 161
Query  144  MIDWS-----GMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTLPATIASYDN-YNIPAISN 197
             +DW      G   +D DNF  LL  + EK+    +++ V + A   +  N Y+ P ++ 
Sbjct  162  DLDWEYPARRGGVPEDKDNFTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAK 221
Query  198  YVDFMNVLSLDYTGSWAHTV-GHASPFPEQLKTLEAYHKR-------------GAPRHKM 243
            Y D++ ++S+DY    + TV G  SP+ + L     Y+K+             G P +K+
Sbjct  222  YADYITLMSFDYHTPSSDTVTGLNSPL-DSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKL 280
Query  244  VMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTIT 303
            V+ VP+Y RT+ L   +++ +G    GPG  G +TQ  GFL+Y E+C     + N     
Sbjct  281  VLGVPLYGRTYRLADPDQHGLGAPILGPGTAGLYTQEAGFLAYYEICS--NPDWNVVW-- 336
Query  304  RDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGD 363
               ++T+ Y +Y + ++ +W+S++D +T+  KA+ + ++   G+ V++L ++D HG CG 
Sbjct  337  ---NDTSSY-LYAYKDY-QWLSYDDPNTITIKAQWVLEKNLGGVMVWSLESDDFHGNCGK 391
Query  364  KN-PLLHAI 371
               PLL A+
Sbjct  392  GAYPLLTAV 400

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.