The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTRLSFTVLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSH
IVYSYFGIDASSHEIKLLDQYLMITLHDMEHFTKHKGNAKAMIAVGGASMSDQFSKTAAV
EHYRETFVVSTIDLMTKYGFDGVMIDWSGMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTL
PATIASYDNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASALPEQLKTLEAYNKRGAPR
HKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAF
SITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGV
CGDKNPLLHAINSNYFRGIVTEPTVVTVTPVTHTTEHVTDIPGVFHCHQEGFFRDKTYCA
KYYECKKGDFGLEQTVHHCPNHSQAFDEVSRTCVDHAKIPGC
Sequence Info Allergen Name Length Opt Bits Score E Value
Q4JK71 Der p 18.0101 462 3169 728.7 1.6e-211
AAM19082 Der f 18.0101 462 2895 666.2 9.9e-193
AAD52672 Der f 15.0101 555 331 81.7 1.1e-16
Q4JK69 Der p 15.0101 532 318 78.7 7.9e-16
Q4JK70 Der p 15.0102 558 318 78.7 8.3e-16
AII81930 Bla g 12.0101 539 277 69.4 5.2e-13
AKH04311 Per a 12.0101 407 243 61.7 8.1e-11
Q17282 Blo t 12 144 119 34.1 0.006
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 728.7 bits 3169,  Expect = 2e-211
 Identities = 462/462 100%, Positives = 462/462 100%, Gaps = 0/462 0%
Query  1    MTRLSFTVLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSH 60
            MTRLSFTVLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSH
Sbjct  1    MTRLSFTVLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSH 60
Query  61   IVYSYFGIDASSHEIKLLDQYLMITLHDMEHFTKHKGNAKAMIAVGGASMSDQFSKTAAV 120
            IVYSYFGIDASSHEIKLLDQYLMITLHDMEHFTKHKGNAKAMIAVGGASMSDQFSKTAAV
Sbjct  61   IVYSYFGIDASSHEIKLLDQYLMITLHDMEHFTKHKGNAKAMIAVGGASMSDQFSKTAAV 120
Query  121  EHYRETFVVSTIDLMTKYGFDGVMIDWSGMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTL 180
            EHYRETFVVSTIDLMTKYGFDGVMIDWSGMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTL
Sbjct  121  EHYRETFVVSTIDLMTKYGFDGVMIDWSGMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTL 180
Query  181  PATIASYDNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASALPEQLKTLEAYNKRGAPR 240
            PATIASYDNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASALPEQLKTLEAYNKRGAPR
Sbjct  181  PATIASYDNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASALPEQLKTLEAYNKRGAPR 240
Query  241  HKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAF 300
            HKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAF
Sbjct  241  HKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAF 300
Query  301  SITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGV 360
            SITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGV
Sbjct  301  SITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGV 360
Query  361  CGDKNPLLHAINSNYFRGIVTEPTVVTVTPVTHTTEHVTDIPGVFHCHQEGFFRDKTYCA 420
            CGDKNPLLHAINSNYFRGIVTEPTVVTVTPVTHTTEHVTDIPGVFHCHQEGFFRDKTYCA
Sbjct  361  CGDKNPLLHAINSNYFRGIVTEPTVVTVTPVTHTTEHVTDIPGVFHCHQEGFFRDKTYCA 420
Query  421  KYYECKKGDFGLEQTVHHCPNHSQAFDEVSRTCVDHAKIPGC 462
            KYYECKKGDFGLEQTVHHCPNHSQAFDEVSRTCVDHAKIPGC
Sbjct  421  KYYECKKGDFGLEQTVHHCPNHSQAFDEVSRTCVDHAKIPGC 462

Sequence Alignment: 2. Allergen Name: Der f 18.0101 Sequence ID: AAM19082

 Score = 666.2 bits 2895,  Expect = 1e-192
 Identities = 411/462 88%, Positives = 444/462 96%, Gaps = 0/462 0%
Query  1    MTRLSFTVLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSH 60
            MTR+S+TVL  LAA FGSNIRPNVATL+PKTVCYYESWVHWRQG+GKMDPEDIDTSLC+H
Sbjct  1    MTRFSLTVLAVLAACFGSNIRPNVATLEPKTVCYYESWVHWRQGEGKMDPEDIDTSLCTH 60
Query  61   IVYSYFGIDASSHEIKLLDQYLMITLHDMEHFTKHKGNAKAMIAVGGASMSDQFSKTAAV 120
            IVYSYFGIDA++HEIKLLD+YLM  LHDMEHFT+HKGNAKAMIAVGG++MSDQFSKTAAV
Sbjct  61   IVYSYFGIDAATHEIKLLDEYLMKDLHDMEHFTQHKGNAKAMIAVGGSTMSDQFSKTAAV 120
Query  121  EHYRETFVVSTIDLMTKYGFDGVMIDWSGMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTL 180
            EHYRETFVVST+DLMT+YGFDGVMIDWSGMQAKDSDNF+KLLDKFDEKFA+TSFVMGVTL
Sbjct  121  EHYRETFVVSTVDLMTRYGFDGVMIDWSGMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTL 180
Query  181  PATIASYDNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASALPEQLKTLEAYNKRGAPR 240
            PATIASYDNYNIPAISNYVDFMNVL+LDY G WA+TVGHAS +PEQLKTLEAY+KRGAPR
Sbjct  181  PATIASYDNYNIPAISNYVDFMNVLSLDYTGSWAHTVGHASPFPEQLKTLEAYHKRGAPR 240
Query  241  HKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAF 300
            HKMVMAVPF+ARTWILEKM+KQD+GDKASGPGP+GQFTQT GFLSYNELCVQIQAETNAF
Sbjct  241  HKMVMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAF 300
Query  301  SITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGV 360
            +ITRDHDNTAIYAVYVH NHAEWISFEDRHTLG+KA+NIT+QGY GMSVYTLSNEDVHGV
Sbjct  301  TITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGV 360
Query  361  CGDKNPLLHAINSNYFRGIVTEPTVVTVTPVTHTTEHVTDIPGVFHCHQEGFFRDKTYCA 420
            CGDKNPLLHAI SNY+ G+VTEPTVVT+ PVTHTTEHVTDIPGVFHCH+EGFFRDKTYCA
Sbjct  361  CGDKNPLLHAIQSNYYHGVVTEPTVVTLPPVTHTTEHVTDIPGVFHCHEEGFFRDKTYCA 420
Query  421  KYYECKKGDFGLEQTVHHCPNHSQAFDEVSRTCVDHAKIPGC 462
             YYECKKGDFGLE+TVHHC NH QAFDEVSRTC+DH KIPGC
Sbjct  421  TYYECKKGDFGLEKTVHHCANHLQAFDEVSRTCIDHTKIPGC 462

Sequence Alignment: 3. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 81.7 bits 331,  Expect = 1e-16
 Identities = 128/362 35%, Positives = 195/362 53%, Gaps = 54/362 14%
Query  30   KTVCYYESWVHWRQGDGKMDP---EDIDTSLCSHIVYSYFGIDASSHEIKLLDQYLMITL 86
            + VCY  +W  +     K+DP   EDID   C+H++Y +  ID   + I+++D Y     
Sbjct  34   RIVCYVGTWSVYH----KVDPYTIEDIDPFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNH 89
Query  87   HDMEHFTKHKGNA--------KAMIAVGG-ASMSDQFSKTAAVEHYRETFVVSTIDLMTK 137
            +  E     + N           MI++GG    S+++S  AA   YR+ F+ S +D++ +
Sbjct  90   NSWEKRGYERFNNLRLKNPELTTMISLGGWYEGSEKYSDMAANPTYRQQFIQSVLDFLQE 149
Query  138  YGFDGVMIDWS------GMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTLPATIASYDN-Y 190
            Y FDG+ +DW       G    D  N++ L+ ++ + F    +++   +       D  Y
Sbjct  150  YKFDGLDLDWEYPGSRLGNPKIDKQNYLALVRELKDAFEPHGYLLTAAVSPGKDKIDRAY 209
Query  191  NIPAISNYVDFMNVLTLDYDGPWAYTVGHASAL---PEQLK----------TLEAYNKRG 237
            +I  ++   D+MNV+T DY G W    GH + L   P++            T+  Y   G
Sbjct  210  DIKELNKLFDWMNVMTYDYHGGWENFYGHNAPLYKRPDETDELHTYFNVNYTMHYYLNNG 269
Query  238  APRHKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAET 297
            A R K+VM VPF+ R W +E   K  +GD A G  P G  +   G LSY ELC   Q E 
Sbjct  270  ATRDKLVMGVPFYGRAWSIEDRSKLKLGDPAKGMSPPGFISGEEGVLSYIELCQLFQKEE 329
Query  298  NAFSITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDV 357
              + I  D    A Y      N   W+ ++D  ++  K   + E G  G+ V++L N+D 
Sbjct  330  --WHIQYDEYYNAPYGY----NDKIWVGYDDLASISCKLAFLKELGVSGVMVWSLENDDF 383
Query  358  HGVCGDKNPLLHAINS-------NYFRGIV----TEPTVVTVTPVTHTTEHVTDIP 402
             G CG KNPLL+ +++       N F  I+    T PT  T TP T TT   T  P
Sbjct  384  KGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTPTPTT-TPTTPTTTPTTPSP 438

Sequence Alignment: 4. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 78.7 bits 318,  Expect = 8e-16
 Identities = 130/386 33%, Positives = 206/386 53%, Gaps = 55/386 14%
Query  3    RLSFTVLIFLAAY--FGSNIR--PNVATLDP-KTVCYYESWVHWRQGDGKMDP---EDID 54
            + S  +LI++A +    + ++   N  + +P + VCY  +W  +     K+DP   EDID
Sbjct  2    KTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYH----KVDPYTIEDID 57
Query  55   TSLCSHIVYSYFGIDASSHEIKLLDQYL-----MITLHDMEHFTKHK-GNAK--AMIAVG 106
               C+H++Y +  ID   + I+++D Y          H  E F   +  N +   MI++G
Sbjct  58   PFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLG 117
Query  107  G-ASMSDQFSKTAAVEHYRETFVVSTIDLMTKYGFDGVMIDWS------GMQAKDSDNFV 159
            G    S+++S   A   YR+ FV S +D++ +Y FDG+ +DW       G    D  N++
Sbjct  118  GWYEGSEKYSDMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL 177
Query  160  KLLDKFDEKFAQTSFVMGVTLPATIASYD-NYNIPAISNYVDFMNVLTLDYDGPWAYTVG 218
             L+ ++ E F    +++   +       D  Y +  ++   D+MNV+T DY G W    G
Sbjct  178  TLVRELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFG 237
Query  219  HASAL---PEQLK----------TLEAYNKRGAPRHKMVMAVPFFARTWILEKMDKQDVG 265
            H + L   P++            T+  Y   GA R K+VM VPF+ R W +E   K  +G
Sbjct  238  HNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLG 297
Query  266  DKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAFSITRDHDNTAIYAVYVHDNHAEWIS 325
            D A G  P G  T   G LSY ELC   Q E   + I  D    A Y      N   W+ 
Sbjct  298  DPAKGMSPPGFITGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIWVG 351
Query  326  FEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGVCGDKNPLLHAINSNYFRG------- 378
            ++D  ++  K   + E G  G+ +++L N+D  G CG K PLL+ ++ N   G       
Sbjct  352  YDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVH-NMINGDEKNSYE 410
Query  379  IVTEPTVVTVTPVTHTTEHVT 399
             +  P+  T TP T +T   T
Sbjct  411  CLLGPSTTTPTPTTPSTPSTT 431

Sequence Alignment: 5. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 78.7 bits 318,  Expect = 8e-16
 Identities = 130/386 33%, Positives = 206/386 53%, Gaps = 55/386 14%
Query  3    RLSFTVLIFLAAY--FGSNIR--PNVATLDP-KTVCYYESWVHWRQGDGKMDP---EDID 54
            + S  +LI++A +    + ++   N  + +P + VCY  +W  +     K+DP   EDID
Sbjct  2    KTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYH----KVDPYTIEDID 57
Query  55   TSLCSHIVYSYFGIDASSHEIKLLDQYL-----MITLHDMEHFTKHK-GNAK--AMIAVG 106
               C+H++Y +  ID   + I+++D Y          H  E F   +  N +   MI++G
Sbjct  58   PFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLG 117
Query  107  G-ASMSDQFSKTAAVEHYRETFVVSTIDLMTKYGFDGVMIDWS------GMQAKDSDNFV 159
            G    S+++S   A   YR+ FV S +D++ +Y FDG+ +DW       G    D  N++
Sbjct  118  GWYEGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL 177
Query  160  KLLDKFDEKFAQTSFVMGVTLPATIASYD-NYNIPAISNYVDFMNVLTLDYDGPWAYTVG 218
             L+ ++ E F    +++   +       D  Y +  ++   D+MNV+T DY G W    G
Sbjct  178  TLVRELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFG 237
Query  219  HASAL---PEQLK----------TLEAYNKRGAPRHKMVMAVPFFARTWILEKMDKQDVG 265
            H + L   P++            T+  Y   GA R K+VM VPF+ R W +E   K  +G
Sbjct  238  HNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLG 297
Query  266  DKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAFSITRDHDNTAIYAVYVHDNHAEWIS 325
            D A G  P G  T   G LSY ELC   Q E   + I  D    A Y      N   W+ 
Sbjct  298  DPAKGMSPPGFITGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIWVG 351
Query  326  FEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGVCGDKNPLLHAINSNYFRG------- 378
            ++D  ++  K   + E G  G+ +++L N+D  G CG K PLL+ ++ N   G       
Sbjct  352  YDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVH-NMINGDEKNSYE 410
Query  379  IVTEPTVVTVTPVTHTTEHVT 399
             +  P+  T TP T +T   T
Sbjct  411  CLLGPSTTTPTPTTPSTPSTT 431

Sequence Alignment: 6. Allergen Name: Bla g 12.0101 Sequence ID: AII81930

 Score = 69.4 bits 277,  Expect = 5e-13
 Identities = 115/377 30%, Positives = 202/377 53%, Gaps = 36/377 9%
Query  8    VLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSHIVYSYFG 67
            +L +    F S +         + VCY+ +W  +R G G    EDI T LC+H++YS+ G
Sbjct  6    ILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIG 65
Query  68   IDASSHEIKLLDQYLMITLHDMEHFT--KHKGNAKAMIAVGGASMSD-QFSKTAAVEHYR 124
            +   +    +LDQ   + L    +FT  K KG  K  +A+GG      ++S   + +  R
Sbjct  66   VSNVTWGPLILDQENDVDLRGFLNFTDLKAKG-VKTSVAMGGWGEGGRKYSHLVSDKKLR 124
Query  125  ETFVVSTIDLMTKYGFDGVMIDWS-------GMQAKDSDNFVKLLDKFDEKFAQTSFVMG 177
            +TF+ + ++++ KY FDG+ IDW        G    D  NF  +++++   F +      
Sbjct  125  DTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWE 184
Query  178  VTLPATIASY---DNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASAL---PEQLKTLE 231
            +T+   +A++   + Y++P +   +D ++V+  D  G WA      S L   P +    +
Sbjct  185  ITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEGYGYQ 244
Query  232  AYNK---------RGAPRHKMVMAVPFFARTWILEKMD-KQDVG---DKASGPGPKGQFT 278
            A N          +G    K+V+  PF+ RT+ L + +  +D+G   +K +G G  G +T
Sbjct  245  ALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYT 304
Query  279  QTPGFLSYNELCVQIQAETNAFSITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARN 338
               G L+Y E+C  +Q   NA   T+  D+      Y +D+  +W+ +++  +L  K   
Sbjct  305  GAKGMLAYYEICNMLQV--NASKWTQKFDDIG-KCPYAYDDGNQWVGYDNEISLQYKMDF 361
Query  339  ITEQGYGGMSVYTLSNEDVHGVCGDKNPLLHAINSNYFRGIVTEPTV-VTVTP 390
            I E+GY G   + +  +D HG CG KNPL++ +  N    +V  PT+ ++ TP
Sbjct  362  IKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVV--PTLQISTTP 412

Sequence Alignment: 7. Allergen Name: Per a 12.0101 Sequence ID: AKH04311

 Score = 61.7 bits 243,  Expect = 8e-11
 Identities = 122/337 36%, Positives = 201/337 59%, Gaps = 42/337 12%
Query  28   DPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSHIVYSYFGIDASSHEIKLLDQYLMITLH 87
            D    CYY SW  +R G    + ++IDT LC+HIVY++ G+      I  LD+Y     +
Sbjct  41   DRAVFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYAFTGL--RDGVIVSLDEYNDYEEN 98
Query  88   ----DMEHFT---KHKGNAKAMIAVGGASM-SDQFSKTAAVEHYRETFVVSTIDLMTKYG 139
                 M+ FT   K+ G  KA++ +GG +  S ++S+ AA +  RETF  S + ++ K G
Sbjct  99   WGKGLMKKFTTLAKNNG-IKALVGLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQG 157
Query  140  FDGVMIDWS-----GMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTLPATIASYDN-YNIP 193
            FDG+ +DW      G   +D DNF  LL  + EK+    +++ V + A   +  N Y+ P
Sbjct  158  FDGLDLDWEYPARRGGVPEDKDNFTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFP 217
Query  194  AISNYVDFMNVLTLDYDGPWAYTV-GHASALPEQLKTLEAYNKR-------------GAP 239
             ++ Y D++ ++++DY  P + TV G  S L + L     YNK+             G P
Sbjct  218  NVAKYADYITLMSFDYHTPSSDTVTGLNSPL-DSLPQDTGYNKKLNVKYSVNQWLKGGVP 276
Query  240  RHKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNA 299
             +K+V+ VP++ RT+ L   D++ +G    GPG  G +TQ  GFL+Y E+C         
Sbjct  277  PNKLVLGVPLYGRTYRLADPDQHGLGAPILGPGTAGLYTQEAGFLAYYEICSNPD----- 331
Query  300  FSITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHG 359
            +++  +  ++ +YA        +W+S++D +T+  KA+ + E+  GG+ V++L ++D HG
Sbjct  332  WNVVWNDTSSYLYAY----KDYQWLSYDDPNTITIKAQWVLEKNLGGVMVWSLESDDFHG 387
Query  360  VCGDKN-PLLHAINSNYFR 377
             CG    PLL A+N    R
Sbjct  388  NCGKGAYPLLTAVNKALGR 406

Sequence Alignment: 8. Allergen Name: Blo t 12 Sequence ID: Q17282

 Score = 34.1 bits 119,  Expect = 0.006
 Identities = 29/72 40%, Positives = 36/72 50%, Gaps = 14/72 19%
Query  382  EPTVVTVTP------VTHTTEHVTDI---PG--VFH--CHQEGFFRDKTYCAKYYECKKG 428
            E  V T TP       T  T H  D+    G   +H  CH+EG    +  C KY  C K 
Sbjct  57   EEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKS 116
Query  429  DFGLEQTVHHCPNHSQAFDEVSRTCV 454
                  TV  C   ++ FD +SR CV
Sbjct  117  GSLWYITVMPCSIGTK-FDPISRNCV 141

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.