The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MTSVKLSTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA
VAAARKAFNGPWAKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA
AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKSLLVFAVRSSMELPILMWSWKIGPAIAT
GNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFTG
STVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCAG
SRIYVQEEIYDKFIQRFKERAAQNAVGDPFAATLQGPQVSQLQFDRIMGYIEEGKKSGAT
IETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTTYG
LSAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDNYI
QTKTVSIRLGDVLFG
Sequence Info Allergen Name Length Opt Bits Score E Value
P42041 Alt a 10 495 3230 742.5 1.2e-215
P40108 Cla h 10.0101 496 2573 592.8 1.5e-170
AOD75396 Tyr p 35.0101 486 1455 337.9 7.4e-94
17291858 Har a 2.0101 514 466 112.5 5.8e-26
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Alt a 10 Sequence ID: P42041

 Score = 742.5 bits 3230,  Expect = 1e-215
 Identities = 495/495 100%, Positives = 495/495 100%, Gaps = 0/495 0%
Query  1    MTSVKLSTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA 60
            MTSVKLSTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA
Sbjct  1    MTSVKLSTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA 60
Query  61   VAAARKAFNGPWAKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA 120
            VAAARKAFNGPWAKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA
Sbjct  61   VAAARKAFNGPWAKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA 120
Query  121  AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKSLLVFAVRSSMELPILMWSWKIGPAIAT 180
            AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKSLLVFAVRSSMELPILMWSWKIGPAIAT
Sbjct  121  AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKSLLVFAVRSSMELPILMWSWKIGPAIAT 180
Query  181  GNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFTG 240
            GNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFTG
Sbjct  181  GNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFTG 240
Query  241  STVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCAG 300
            STVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCAG
Sbjct  241  STVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCAG 300
Query  301  SRIYVQEEIYDKFIQRFKERAAQNAVGDPFAATLQGPQVSQLQFDRIMGYIEEGKKSGAT 360
            SRIYVQEEIYDKFIQRFKERAAQNAVGDPFAATLQGPQVSQLQFDRIMGYIEEGKKSGAT
Sbjct  301  SRIYVQEEIYDKFIQRFKERAAQNAVGDPFAATLQGPQVSQLQFDRIMGYIEEGKKSGAT 360
Query  361  IETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTTYG 420
            IETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTTYG
Sbjct  361  IETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTTYG 420
Query  421  LSAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDNYI 480
            LSAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDNYI
Sbjct  421  LSAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDNYI 480
Query  481  QTKTVSIRLGDVLFG 495
            QTKTVSIRLGDVLFG
Sbjct  481  QTKTVSIRLGDVLFG 495

Sequence Alignment: 2. Allergen Name: Cla h 10.0101 Sequence ID: P40108

 Score = 592.8 bits 2573,  Expect = 1e-170
 Identities = 383/494 77%, Positives = 438/494 88%, Gaps = 3/494 0%
Query  1    MTSVKLSTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA 60
            MTSV+L TP++G++EQPTGLFINNEFVK  +GKTFDVINPS E VI  V+EATEKDVDIA
Sbjct  1    MTSVQLETPHSGKYEQPTGLFINNEFVKGQEGKTFDVINPSDESVITQVHEATEKDVDIA 60
Query  61   VAAARKAFNGPWAKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA 120
            VAAAR+AF G W  ETPENRGKLLN LA+LFEKN DL+AAVE+LDNGKA SMA+ V    
Sbjct  61   VAAARQAFEGSWRLETPENRGKLLNNLANLFEKNTDLLAAVESLDNGKATSMAR-VTSAC 119
Query  121  AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKSLL-VFAVRSSMELPILMWSWKIGPAIA 179
            A+GCLRYYGGWADKI GKV+DT PD+FNY++K  + V     S+ELP+LMW+WKIGPAIA
Sbjct  120  ASGCLRYYGGWADKITGKVIDTTPDTFNYVKKEPIGVCRSDHSLELPLLMWAWKIGPAIA 179
Query  180  TGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFT 239
             GNTVVLKTAEQTPL   +A  L++EAGFPPGVINVI+GFGK+AGAA+S+HMD+DK+AFT
Sbjct  180  CGNTVVLKTAEQTPLGGLVAASLVKEAGFPPGVINVISGFGKVAGAALSSHMDVDKVAFT 239
Query  240  GSTVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCA 299
            GSTVVGR I+K+AA SNLKKVTLELGGKSPNIVF DAD+D AI WVNFGI+FNHGQ CCA
Sbjct  240  GSTVVGRTILKAAASSNLKKVTLELGGKSPNIVFEDADIDNAISWVNFGIFFNHGQCCCA 299
Query  300  GSRIYVQEEIYDKFIQRFKERAAQNAVGDPFAA-TLQGPQVSQLQFDRIMGYIEEGKKSG 358
            GSR+YVQE IYDKF+Q+FKERA +N VGDPFAA T+QGPQVS++QFDRIM YI+ GK +G
Sbjct  300  GSRVYVQESIYDKFVQKFKERAQKNVVGDPFAADTFQGPQVSKVQFDRIMEYIQAGKDAG 359
Query  359  ATIETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTT 418
            AT+ETGG+RKGDKGYFIEPTIFSNVTEDMKI +EEIFGPVC+I+KFKTK D IK+GN +T
Sbjct  360  ATVETGGSRKGDKGYFIEPTIFSNVTEDMKIVKEEIFGPVCSIAKFKTKEDAIKLGNAST 419
Query  419  YGLSAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDN 478
            YGL+AAVHT NL TAIEV+NAL+AGTVWVN+YNTLH Q+PFGGYKESGIGRELGE AL N
Sbjct  420  YGLAAAVHTKNLNTAIEVSNALKAGTVWVNTYNTLHHQMPFGGYKESGIGRELGEDALAN 479
Query  479  YIQTKTVSIRLGDVLFG 495
            Y QTKTVSIRLGD LFG
Sbjct  480  YTQTKTVSIRLGDALFG 496

Sequence Alignment: 3. Allergen Name: Tyr p 35.0101 Sequence ID: AOD75396

 Score = 337.9 bits 1455,  Expect = 7e-94
 Identities = 236/469 50%, Positives = 313/469 66%, Gaps = 8/469 1%
Query  18   TGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIAVAAARKAFN--GPWAKE 75
            T +FINNE+  +V GKTF VINP+TEE I  VQE  + D+D AV AAR+AF     W   
Sbjct  9    TQIFINNEWHNSVSGKTFPVINPATEEKIADVQEGDKADIDKAVTAAREAFKLGSTWRSM 68
Query  76   TPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPAAAGCLRYYGGWADKI 135
                RG+L+NKLADL E     ++ +E+LDNGK ++ A+  D+      +RYY GWADKI
Sbjct  69   DASARGRLINKLADLIEIERQYLSELESLDNGKPLAEAE-FDLDCTVATFRYYAGWADKI 127
Query  136  EGKVV--DTAPDSFNYIRKSLLVFAVRSSMELPILMWSWKIGPAIATGNTVVLKTAEQTP 193
             GK +  D    SF  I + + V         P LM +WK  PA+A GNTV+LK AEQTP
Sbjct  128  HGKTIPADGPVVSFTKI-EPVGVCGQIIPWNYPALMLAWKWAPALAAGNTVILKPAEQTP 186
Query  194  LSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFTGSTVVGRQIMKSAA 253
            LSA    KL  EAGFPPGVINV+ G+G  AGAA+ AH  +DKIAFTGST +G+ I K+A+
Sbjct  187  LSALYIAKLAAEAGFPPGVINVVPGYGPTAGAALVAHPRVDKIAFTGSTEIGKLISKTAS 246
Query  254  GSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCAGSRIYVQEEIYDKF 313
               LK+VTLELGGKSP +V    D+ EA +  +   + N GQ CCAG+R YV+E IY++F
Sbjct  247  -ETLKRVTLELGGKSPLVVTESVDIPEAAQIAHDACFANMGQCCCAGTRTYVHESIYEEF 305
Query  314  IQRFKERAAQNAVGDPFAATL-QGPQVSQLQFDRIMGYIEEGKKSGATIETGGNRKGDKG 372
            ++     A +  +G PF A + QGPQ+   Q  +I+  IE GKK GA + TGG R   KG
Sbjct  306  VKHSAAIANKRVLGSPFDANVTQGPQIDAAQTAKILDLIESGKKQGARVVTGGQRSTRKG 365
Query  373  YFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTTYGLSAAVHTSNLTT 432
            YFIEPT+F++VT+ M+I QEEIFGPV  I K+K+  +VI   N++ YGL+A + T ++  
Sbjct  366  YFIEPTVFADVTDSMRIAQEEIFGPVQQILKYKSLDEVIDRCNSSAYGLAAGILTKDINQ 425
Query  433  AIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDNYIQTKTVSIRL 489
            A++ + A++AG+VWVN Y+    Q PFGG+K+SG GRELGE  L  Y + KTV+I+L
Sbjct  426  ALKFSGAVQAGSVWVNCYDHTVVQTPFGGFKQSGHGRELGEEGLHGYCEVKTVTIKL 482

Sequence Alignment: 4. Allergen Name: Har a 2.0101 Sequence ID: 17291858

 Score = 112.5 bits 466,  Expect = 6e-26
 Identities = 101/295 34%, Positives = 152/295 51%, Gaps = 17/295 5%
Query  176  PAIATGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDK 235
            PA+A GN V+ K ++   LS +   K+ +EAG P GV+N +   G + G  ++A      
Sbjct  174  PALA-GNAVLWKPSDTALLSNWQIFKICREAGVPAGVVNFVPADGPVFGDTITASPHFAG 232
Query  236  IAFTGSTVVGRQIMKSAAGSNLKK------VTLELGGKSPNIVFADADLDEAIHWVNFGI 289
            + FTGS V   Q + +  G NL +      +  E GGK+ + +   AD+   ++      
Sbjct  233  LNFTGS-VPTFQRLWNQVGQNLNRYINFPRLIGECGGKNYHFIHPSADVQSVVNGTIRSA 291
Query  290  YFNHGQACCAGSRIYVQEEIYDKFIQRFKERAAQNAVGDPFAA-TLQGPQVSQLQFDRIM 348
            +   GQ C A SR+YV E ++ K    +     +  +GDP    T+ G  +    FDRI 
Sbjct  292  FEYCGQKCSACSRMYVPESLWPKIKDGLIAERNKLKIGDPTEVDTFTGAVIDARAFDRIS 351
Query  349  GYIEEGKKSGA-TIETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKT- 406
            GYI   K S   +I  GG      GYFIEPTI  +     KI  EEIFGPV  +  +K  
Sbjct  352  GYINHAKNSSNLSIVAGGKCDNSVGYFIEPTIVQSTDPKDKIMTEEIFGPVLAVYVYKDG 411
Query  407  KADVIK--IGNNTTYGLSAAVHTSNLTTAIEVANALR--AGTVWVN--SYNTLHWQLPFG 460
            K D I   I ++T + L+ AV   ++    +  + L+  AG  ++N  S  ++  Q PFG
Sbjct  412  KEDEIMGLIESSTQFALTGAVFAKDVAFQKKALDTLKITAGNFYINDKSTGSVVGQQPFG 471
Query  461  GYKESGIGRELG 472
            G + SG   + G
Sbjct  472  GARMSGTNDKAG 483

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.