The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL
DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV
STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL
IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ
VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL
Sequence Info Allergen Name Length Opt Bits Score E Value
ABB88514 Bomb m 1.0101 355 2362 544.8 2e-156
Q95PM9 Plo i 1 355 2205 509.1 1.2e-145
ABC86902 Bla g 9.0101 356 2101 485.3 1.6e-138
H6VGI3 Scy p 2.0101 357 2013 465.3 1.8e-132
Q004B5 Lit v 2.0101 356 2012 465.1 2.1e-132
H6VGI2 Pro c 2.0101 357 2000 462.3 1.4e-131
AAO15713 Pen m 2 356 1988 459.6 9.2e-131
A0A868BHP5 Tyr p 20.0101 357 1905 440.7 4.6e-125
AIO08850 Der f 20.0101 356 1897 438.8 1.6e-124
ACD50950 Der p 20.0101 356 1869 432.5 1.3e-122
ABU97470 Der f 20.0201 356 1848 427.7 3.7e-121
XP_026780620 Pan h 7.0101 380 984 230.7 7.8e-62
ACH70914 Sal s 7.01 381 932 218.9 2.9e-58
E2JE77 Mac r 2.0101 355 863 203.1 1.4e-53
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bomb m 1.0101 Sequence ID: ABB88514

 Score = 544.8 bits 2362,  Expect = 2e-156
 Identities = 355/355 100%, Positives = 355/355 100%, Gaps = 0/355 0%
Query  1    MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 60
            MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL
Sbjct  1    MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 60
Query  61   DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV 120
            DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV
Sbjct  61   DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV 120
Query  121  STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL 180
            STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL
Sbjct  121  STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL 180
Query  181  IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ 240
            IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ
Sbjct  181  IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ 240
Query  241  VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA 300
            VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
Sbjct  241  VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA 300
Query  301  SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL
Sbjct  301  SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355

Sequence Alignment: 2. Allergen Name: Plo i 1 Sequence ID: Q95PM9

 Score = 509.1 bits 2205,  Expect = 1e-145
 Identities = 328/355 92%, Positives = 344/355 96%, Gaps = 0/355 0%
Query  1    MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 60
            MVDAATLEKLEAGFSKL  SDSKSLLKKYLTREVFD+LKNKKTSFGSTLLD IQSGVENL
Sbjct  1    MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLLDSIQSGVENL 60
Query  61   DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV 120
             SGVGIYAPDAE+Y VFA+LFDPIIEDYHNGFKKTDKHPPKNWGDV+TLGNLDPAGEFVV
Sbjct  61   HSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPPKNWGDVETLGNLDPAGEFVV 120
Query  121  STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL 180
            STRVRCGRS+EGYPFNPCLTE+QYKEME+KVS TLS LEGELKGTF+PLTGMSKETQQQL
Sbjct  121  STRVRCGRSMEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTFFPLTGMSKETQQQL 180
Query  181  IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ 240
            IDDHFLFKEGDRFLQAANACRFWP+GRGIYHNENKTFLVWCNEEDHLR+ISMQMGGDL+Q
Sbjct  181  IDDHFLFKEGDRFLQAANACRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQ 240
Query  241  VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA 300
            VYKRLV  VN+I K+IPFSH++RLGFLTFCPTNLGTTVRASVHIKLPKLAADK KLEEVA
Sbjct  241  VYKRLVRGVNDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA 300
Query  301  SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEY+AVKEMYDGIAELIKIEKSL
Sbjct  301  SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIKIEKSL 355

Sequence Alignment: 3. Allergen Name: Bla g 9.0101 Sequence ID: ABC86902

 Score = 485.3 bits 2101,  Expect = 2e-138
 Identities = 309/355 87%, Positives = 335/355 94%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKT-SFGSTLLDCIQSGVEN 59
            MVDAA LEKLEAGF+KL  SDSKSLL+KYLT+EVFD+LK KKT +FGSTLLD IQSG+EN
Sbjct  1    MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
             DSGVGIYAPDAE+Y+VFA+LFDPIIEDYH GFKKTDKHPPK+WGDVDTLGNLDPAGE++
Sbjct  61   HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRS++GYPFNPCLTE+QYKEMEDKVS TLS LEGELKG FYPLTGM+KE QQ+
Sbjct  121  ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQ ANACRFWPTGRGIYHN+ KTFLVWCNEEDHLRIISMQMGGDL 
Sbjct  181  LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            QVY+RLV+AVN+IEK++PFSH DRLGFLTFCPTNLGTTVRASV IK+PKLAADKKKLEEV
Sbjct  241  QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVK M DGIAELIKIE SL
Sbjct  301  AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356

Sequence Alignment: 4. Allergen Name: Scy p 2.0101 Sequence ID: H6VGI3

 Score = 465.3 bits 2013,  Expect = 2e-132
 Identities = 294/355 82%, Positives = 329/355 92%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            M DAA +EKLE GF KL+  +D KSLLKKYLT+ VFD LK KKTS+G+TLLD IQSGVEN
Sbjct  1    MADAAVIEKLEEGFKKLEAATDCKSLLKKYLTKSVFDQLKGKKTSLGATLLDVIQSGVEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVG+YAPDAE+Y++FA LFDPIIEDYH GFK+TDKHP K++GDV+ + N+DP G+FV
Sbjct  61   LDSGVGVYAPDAEAYTLFAPLFDPIIEDYHKGFKQTDKHPNKDFGDVNQFVNVDPDGKFV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRS+EGYPFNPCLTE+QYKEME KVS TLS+LEGELKGT+YPLTGM+K+ QQ+
Sbjct  121  ISTRVRCGRSMEGYPFNPCLTEAQYKEMESKVSSTLSNLEGELKGTYYPLTGMTKDVQQK 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACR+WPTGRGIYHN+NKTFLVWCNEEDHLRIISMQMGGDL 
Sbjct  181  LIDDHFLFKEGDRFLQAANACRYWPTGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDLG 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            QVY+RLVSAVNEIEK++PFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAA+++KLEEV
Sbjct  241  QVYRRLVSAVNEIEKRVPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A KY LQVRGTRGEHTEAEGGVYDISNKRRMGLTE+ AVKEM DGI ELIKIEK +
Sbjct  301  AGKYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 5. Allergen Name: Lit v 2.0101 Sequence ID: Q004B5

 Score = 465.1 bits 2012,  Expect = 2e-132
 Identities = 296/355 83%, Positives = 331/355 93%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            M DAA +EKLEAGF KL+  +D KSLLKKYLT+EVFD LK+K+TS+G+TLLD IQSGVEN
Sbjct  1    MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVGIYAPDAE+Y++FA LFDPIIEDYH GFK+TDKHP K++GDV+++ N+DP G+FV
Sbjct  61   LDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRSL+GYPFNPCLTESQYKEME KVS TLSSLEGELKGT+YPLTGMSKE QQ+
Sbjct  121  ISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQK 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACR+WP GRGIYHN+NKTFLVW NEEDHLRIISMQMGGDL 
Sbjct  181  LIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLG 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            QV++RL SAVNEIEK+IPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAA+++KLEEV
Sbjct  241  QVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A KY+LQVRGTRGEHTEAEGG+YDISNKRRMGLTE+ AVKEM DGI ELIKIEK +
Sbjct  301  AGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 6. Allergen Name: Pro c 2.0101 Sequence ID: H6VGI2

 Score = 462.3 bits 2000,  Expect = 1e-131
 Identities = 291/355 81%, Positives = 328/355 92%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            M DAAT+ KLE GF KL+  +D KSLLKKYL++ +FDSLK KKT +G+TLLD IQSGVEN
Sbjct  1    MADAATIAKLEEGFKKLEAATDCKSLLKKYLSKSIFDSLKAKKTGLGATLLDVIQSGVEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVGIYAPDAE+YS+FA LFDPIIEDYH GFK+TDKHP K++GDV+ + N+DP G+FV
Sbjct  61   LDSGVGIYAPDAEAYSLFAPLFDPIIEDYHKGFKQTDKHPNKDFGDVNQFVNVDPDGKFV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRSLEGYPFNPCLTE+QYKEME+KVS TLS LEGELKGT+YPL GM+KE QQ+
Sbjct  121  ISTRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTYYPLAGMTKEVQQK 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACR+WP GRGIYHN+NKTFLVWCNEEDHLRIISMQMGGDL 
Sbjct  181  LIDDHFLFKEGDRFLQAANACRYWPVGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDLG 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            QVY+RLVSAVN+IEK++PFSHHDRLGFLTFCPTNLGTT+RASVHIKLPKLAA+++KLEEV
Sbjct  241  QVYRRLVSAVNDIEKRVPFSHHDRLGFLTFCPTNLGTTIRASVHIKLPKLAANREKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A++Y LQVRGTRGEHTEAEGGVYDISNKRRMGLTE+ AVKEM DGI ELIKIEK +
Sbjct  301  AARYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 7. Allergen Name: Pen m 2 Sequence ID: AAO15713

 Score = 459.6 bits 1988,  Expect = 9e-131
 Identities = 291/355 81%, Positives = 328/355 92%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            M DAA +EKLEAGF KL+  +D KSLLKKYL++ VFD LK KKTS+G+TLLD IQSGVEN
Sbjct  1    MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVGIYAPDAE+Y++F+ LFDPIIEDYH GFK+TDKHP K++GDV+T+ N+DP G++V
Sbjct  61   LDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRS+EGYPFNPCLTE+QYKEME KVS TLSSLEGELKGT+YPLTGMSKE QQ+
Sbjct  121  ISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQK 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACR+WP GRGIYHN+NKTFLVW NEEDHLRIISMQMGGDL 
Sbjct  181  LIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLG 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            QV++RL SAVNEIEK+IPFSHHDRLGFLTFCPTNLGTT RASVHIKLPKLAA+++KLEEV
Sbjct  241  QVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTARASVHIKLPKLAANREKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A KY+LQVRGTRGEHTEAEGG+YDISNKRRMGLTE+ AVKEM DGI ELIK+EK +
Sbjct  301  AGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM 356

Sequence Alignment: 8. Allergen Name: Tyr p 20.0101 Sequence ID: A0A868BHP5

 Score = 440.7 bits 1905,  Expect = 5e-125
 Identities = 282/355 79%, Positives = 316/355 89%, Gaps = 2/355 0%
Query  1    MVDAATLEKLEAGFSKLQ--GSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVE 58
            MVD ATL+KLEAGF KLQ  G    SLLKKYLT +VF+ LK+KKT  G+TLLD IQSGVE
Sbjct  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
Query  59   NLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEF 118
            NLDSGVG+YAPDAE+Y++FA+LF+P+IE YH GFK TDKHPP ++GD++ L N+DP  EF
Sbjct  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
Query  119  VVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQ 178
            V+STRVRCGRSL+GYPFNPCLTE+QYKEME+KV   L S+EGELKGT+YPLTGM K TQQ
Sbjct  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
Query  179  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDL 238
            QLIDDHFLFKEGDRFLQAANACRFWPTGRGI+HN +KTFL+W NEEDHLRIISMQ GGDL
Sbjct  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
Query  239  QQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEE 298
            ++V+ RLV AV  IEKKIPFS  DRLGFLTFCPTNLGTT+RASVHIKLPKLAAD+KKLEE
Sbjct  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
Query  299  VASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            VA+KY+LQVRGT GEHTE+ GGVYDISNKRRMGLTEY AVKEM DGI ELIKIEKSL
Sbjct  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357

Sequence Alignment: 9. Allergen Name: Der f 20.0101 Sequence ID: AIO08850

 Score = 438.8 bits 1897,  Expect = 2e-124
 Identities = 277/355 78%, Positives = 314/355 88%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQGS-DSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            MVD A ++KLEAGF KLQ S +  SLLKKYLTR V+D+ K +KT  G+TL+D +QSG EN
Sbjct  1    MVDQAVIDKLEAGFQKLQSSAECHSLLKKYLTRNVLDACKGRKTGMGATLVDVVQSGFEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVG+YAPDAESY++F ELFDP+IEDYH GFK TDKHP  ++GDV+TL N+DP  EFV
Sbjct  61   LDSGVGLYAPDAESYTLFKELFDPVIEDYHKGFKPTDKHPQTDFGDVNTLCNVDPNNEFV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRSL+GYPFNPCLTE+QYKEME+KV G L+S+EGELKGT+YPL GM K TQQQ
Sbjct  121  ISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKGQLNSFEGELKGTYYPLLGMDKATQQQ 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACRFWP G GI+HN+NKTFL+W NEEDHLRIISMQ GGDL+
Sbjct  181  LIDDHFLFKEGDRFLQAANACRFWPVGCGIFHNDNKTFLIWVNEEDHLRIISMQKGGDLK 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            QV+ RL++ VN IEKK+PFS  DRLGFLTFCPTNLGTT+RASVHIKLPKLAAD+KKLEEV
Sbjct  241  QVFSRLINGVNHIEKKLPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A KY+LQVRGT GEHTE+ GGVYDISNKRRMGLTEY AVKEM DGI ELIKIEKS+
Sbjct  301  AGKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSM 356

Sequence Alignment: 10. Allergen Name: Der p 20.0101 Sequence ID: ACD50950

 Score = 432.5 bits 1869,  Expect = 1e-122
 Identities = 276/355 77%, Positives = 310/355 87%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQGS-DSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            MVD ATL KLEAGF KLQ + D  SLLKKYLTR+VFD LKNKKT  G+TLLD IQSGVEN
Sbjct  1    MVDPATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVFDQLKNKKTDMGATLLDVIQSGVEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVGIYAPDA+SY  FA LFDPII+DYH GFK TDKHP  ++G+++ + N+DP  E+V
Sbjct  61   LDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPKTDFGNIENFVNVDPKNEYV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRSL GYPFNP LTE+QYKEME KV G L+++EGELKGT+YPL GM K TQQQ
Sbjct  121  LSTRVRCGRSLNGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQQ 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACR+WP GRGI+HN+ KTFL+W NEEDHLRIISMQ GGDL+
Sbjct  181  LIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDLK 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            +VY RLV AV  IE+KIPFS  DRLGFLTFCPTNLGTT+RASVHIKLPKLAAD+KKLEEV
Sbjct  241  EVYGRLVKAVKHIEQKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A +Y+LQVRGT GEHTE+ GG+YDISNKRRMGLTEY AVKEM DGI ELIK+EKS+
Sbjct  301  AGRYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGILELIKMEKSM 356

Sequence Alignment: 11. Allergen Name: Der f 20.0201 Sequence ID: ABU97470

 Score = 427.7 bits 1848,  Expect = 4e-121
 Identities = 272/355 76%, Positives = 311/355 87%, Gaps = 1/355 0%
Query  1    MVDAATLEKLEAGFSKLQGS-DSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 59
            MVD ATL KLEAGF KLQ + D  SLLKKYLTR+V+D LK KKT  G+TLLD IQSGVEN
Sbjct  1    MVDQATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVLDQLKTKKTDMGATLLDVIQSGVEN 60
Query  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
            LDSGVGIYAPDA+SY  FA LFDPII+DYH GFK TDKHP  ++G+++ + N+DP  E+V
Sbjct  61   LDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPQTDFGNIEHFVNVDPKNEYV 120
Query  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
            +STRVRCGRSL+GYPFNP LTE+QYKEME KV G L+++EGELKGT+YPL GM K TQQ+
Sbjct  121  ISTRVRCGRSLKGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQK 180
Query  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
            LIDDHFLFKEGDRFLQAANACR+WP GRGI+HN+ KTFL+W NEEDHLRIISMQ GGDL+
Sbjct  181  LIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDLK 240
Query  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
            +V+ RLV AV  IE+KIPFS  DRLG+LTFCPTNLGTT+RASVHIKLPKLAAD+KKLEEV
Sbjct  241  EVFGRLVKAVKHIEQKIPFSRDDRLGYLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV 300
Query  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            A++Y+LQVRGT GEHTE+ GG+YDISNKRRMGLTEY AVKEM DGI ELIK+EKSL
Sbjct  301  AARYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGIIELIKMEKSL 356

Sequence Alignment: 12. Allergen Name: Pan h 7.0101 Sequence ID: XP_026780620

 Score = 230.7 bits 984,  Expect = 8e-62
 Identities = 155/327 47%, Positives = 223/327 68%, Gaps = 14/327 4%
Query  26   LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELF 81
            + K L +++++ L+ K T  G TL DCIQ+GV+N    +   VG  A D E Y VF +LF
Sbjct  29   MSKALNKDIYNKLRGKSTPSGFTLDDCIQTGVDNPGHPFIMTVGCVAGDEECYEVFKDLF 88
Query  82   DPIIEDYHNGFKKTDKHPPK-NWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLT 140
            DPII D H G+K TDKH    NW ++    +LDP   +V+S+RVR GRS++GY + P  +
Sbjct  89   DPIISDRHGGYKPTDKHHTDLNWENLKGGDDLDP--NYVLSSRVRTGRSIKGYTLPPHNS 146
Query  141  ESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANA 199
              + + +E      L+SL+GE+KG +YPL  M+++ Q+QLI DHFLF K    +L AA  
Sbjct  147  RGERRAVEKLSIEALTSLDGEFKGKYYPLKDMTEKEQEQLIADHFLFDKPVSPLLLAAGM 206
Query  200  CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFS 259
             R WP  RGI+HN+NKTFLVW NEEDHLR+ISMQ GG++++V++R+   +  IE+     
Sbjct  207  ARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQQGGNMKEVFRRFCVGLQRIEEIFKKH 266
Query  260  HH-----DRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVASKYHLQVRGTRGEH 314
            +H     + LGF+  CP+NLGT +R  VH+KLPKL+    K+EE+ ++  LQ RGT G  
Sbjct  267  NHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVD 325
Query  315  TEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            T + GGV+DISN  R+G +E + V+ + DG+  +I++EK L
Sbjct  326  TASVGGVFDISNADRLGSSEVEQVQLVVDGVKLMIEMEKKL 366

Sequence Alignment: 13. Allergen Name: Sal s 7.01 Sequence ID: ACH70914

 Score = 218.9 bits 932,  Expect = 3e-58
 Identities = 150/342 43%, Positives = 229/342 66%, Gaps = 16/342 4%
Query  9    KLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGV 64
            K+E  +  L   ++   + K LT++++  L++K+T  G TL D IQ+GV+N    +   V
Sbjct  15   KVEEEYPDLTKHNNH--MAKVLTKDMYAKLRDKQTPSGFTLDDVIQTGVDNPGHPFIMTV 72
Query  65   GIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPK-NWGDVDTLGNLDPAGEFVVSTR 123
            G  A D ESY +F +L+DPII D H+G+K TDKH    N+ ++    +LDP   +V+S+R
Sbjct  73   GCVAGDEESYEIFKDLLDPIISDRHSGYKPTDKHKTDLNFENLKGGDDLDP--NYVLSSR 130
Query  124  VRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDD 183
            VR GRS++GY + P  +  + + +E      L++L+GE+KG +YPL  M+   Q+QLI D
Sbjct  131  VRTGRSIKGYTLPPHNSRGERRAVEKLSVEALNTLDGEFKGKYYPLNKMTDAEQEQLIAD 190
Query  184  HFLF-KEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVY 242
            HFLF K    +L  A   R WP  RGI+HN+ K+FLVW NEEDHLR+ISM+ GG++++V+
Sbjct  191  HFLFDKPVSPLLLGAGMARDWPDARGIWHNDAKSFLVWVNEEDHLRVISMEKGGNMKEVF 250
Query  243  KRLVSAVNEIEKKIPFSHH-----DRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLE 297
            +R+   +  IE+     +H     + LG++  CP+NLGT +R  VH+KLPKL+    K+E
Sbjct  251  RRFCVGLKRIEETFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HPKFE 309
Query  298  EVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355
            E+ ++  LQ RGT G  T + GGV+DISN  R+G +E D V+ + DG+  ++++EK L
Sbjct  310  EILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQMVVDGVKLMVEMEKKL 367

Sequence Alignment: 14. Allergen Name: Mac r 2.0101 Sequence ID: E2JE77

 Score = 203.1 bits 863,  Expect = 1e-53
 Identities = 152/317 47%, Positives = 207/317 65%, Gaps = 21/317 6%
Query  24   SLLKKYLTREVFDSLKNKKTSF-GSTLLDCIQSGVENLDSGVGIYAPDAESYSVFAELFD 82
            SL+ K++T+E ++ L   KT+  G TL   I   VE  +   GIYA D +SY  F ++FD
Sbjct  13   SLVAKHVTKERWEKLSGHKTATSGFTLKQAIACAVEFDNQHCGIYAGDWDSYKDFKDVFD 72
Query  83   PIIEDYHNGFKKTDKHPPKNWGDVDTL-GNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTE 141
            PII++YH G      H      +V+ + GN++ A   V S R+R GRS++G+ ++P +T+
Sbjct  73   PIIQEYH-GISPDAVHTSDM--EVEKIKGNIN-AEVPVHSVRIRVGRSIDGFGLSPGITK 128
Query  142  SQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACR 201
             Q   +E+ +   +  L G+L G +YPLTGM ++ +QQL+DDHFLF  GDR LQ A   R
Sbjct  129  EQRIGVENLMKSAFGKLSGDLAGNYYPLTGMDEKVRQQLVDDHFLFMSGDRNLQVAGMER 188
Query  202  FWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEI------EKK 255
             WP GRGIYHN  KTFLVW NEED+LRIISMQMGGD++ V++RL   +  +      E  
Sbjct  189  DWPEGRGIYHNAEKTFLVWVNEEDQLRIISMQMGGDVRGVFERLARGIKAVGDSVKAESG 248
Query  256  IPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPK-----LAADKKKLEEVASKYHLQVRGT 310
              F    + GF+  CPTNLGT +RASVH+ LP      L A KK+ EE+     +Q RGT
Sbjct  249  KDFMLDPKYGFVHSCPTNLGTGMRASVHVDLPGWTKEGLDALKKRCEEL----KVQPRGT 304
Query  311  RGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAEL 348
            RGE     G  YDISNK R+G +E + V+ M DG+  L
Sbjct  305  RGESGGQTGHTYDISNKHRLGYSEVELVQCMIDGVNTL 342

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.