The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE
NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF
VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ
QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL
KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE
VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A868BHP5 Tyr p 20.0101 357 2366 545.7 1.1e-156
AIO08850 Der f 20.0101 356 2097 484.4 3.1e-138
ABU97470 Der f 20.0201 356 2066 477.4 4.1e-136
ACD50950 Der p 20.0101 356 2063 476.7 6.6e-136
Q004B5 Lit v 2.0101 356 1942 449.1 1.3e-127
H6VGI2 Pro c 2.0101 357 1920 444.1 4.3e-126
H6VGI3 Scy p 2.0101 357 1919 443.9 5e-126
AAO15713 Pen m 2 356 1908 441.3 2.9e-125
ABB88514 Bomb m 1.0101 355 1905 440.7 4.6e-125
Q95PM9 Plo i 1 355 1867 432.0 1.9e-122
ABC86902 Bla g 9.0101 356 1842 426.3 9.7e-121
XP_026780620 Pan h 7.0101 380 972 228.0 5.2e-61
ACH70914 Sal s 7.01 381 962 225.7 2.5e-60
E2JE77 Mac r 2.0101 355 869 204.5 5.6e-54
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tyr p 20.0101 Sequence ID: A0A868BHP5

 Score = 545.7 bits 2366,  Expect = 1e-156
 Identities = 357/357 100%, Positives = 357/357 100%, Gaps = 0/357 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE
Sbjct  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF
Sbjct  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ
Sbjct  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL
Sbjct  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
            KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE
Sbjct  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL
Sbjct  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357

Sequence Alignment: 2. Allergen Name: Der f 20.0101 Sequence ID: AIO08850

 Score = 484.4 bits 2097,  Expect = 3e-138
 Identities = 311/356 87%, Positives = 331/356 92%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            MVDQA +DKLEAGF+KLQSS + CHSLLKKYLT +V++  K +KTGMGATL+DV+QSG E
Sbjct  1    MVDQAVIDKLEAGFQKLQSSAE-CHSLLKKYLTRNVLDACKGRKTGMGATLVDVVQSGFE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVGLYAPDAE+YTLF +LF+PVIE YH GFK TDKHP +DFGD+N L NVDPNNEF
Sbjct  60   NLDSGVGLYAPDAESYTLFKELFDPVIEDYHKGFKPTDKHPQTDFGDVNTLCNVDPNNEF 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVK QL SFEGELKGTYYPL GMDKATQQ
Sbjct  120  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKGQLNSFEGELKGTYYPLLGMDKATQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            QLIDDHFLFKEGDRFLQAANACRFWP G GIFHN +KTFL+WVNEEDHLRIISMQKGGDL
Sbjct  180  QLIDDHFLFKEGDRFLQAANACRFWPVGCGIFHNDNKTFLIWVNEEDHLRIISMQKGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
            K+VF RL+  V HIEKK+PFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE
Sbjct  240  KQVFSRLINGVNHIEKKLPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA KYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKS+
Sbjct  300  VAGKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSM 356

Sequence Alignment: 3. Allergen Name: Der f 20.0201 Sequence ID: ABU97470

 Score = 477.4 bits 2066,  Expect = 4e-136
 Identities = 306/356 85%, Positives = 334/356 93%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            MVDQATL KLEAGF+KLQ++ D CHSLLKKYLT DV+++LK KKT MGATLLDVIQSGVE
Sbjct  1    MVDQATLSKLEAGFQKLQNAQD-CHSLLKKYLTRDVLDQLKTKKTDMGATLLDVIQSGVE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDA++Y  FA LF+P+I+ YH GFK TDKHP +DFG+I ++VNVDP NE+
Sbjct  60   NLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPQTDFGNIEHFVNVDPKNEY 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRSL+GYPFNP LTEAQYKEME KVK QL +FEGELKGTYYPL GMDKATQQ
Sbjct  120  VISTRVRCGRSLKGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            +LIDDHFLFKEGDRFLQAANACR+WP GRGIFHN  KTFLMWVNEEDHLRIISMQKGGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
            KEVFGRLVKAV+HIE+KIPFSRDDRLG+LTFCPTNLGTTIRASVHIKLPKLAADRKKLEE
Sbjct  240  KEVFGRLVKAVKHIEQKIPFSRDDRLGYLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VAA+YNLQVRGTAGEHTESVGG+YDISNKRRMGLTEYQAVKEMQDGI+ELIK+EKSL
Sbjct  300  VAARYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGIIELIKMEKSL 356

Sequence Alignment: 4. Allergen Name: Der p 20.0101 Sequence ID: ACD50950

 Score = 476.7 bits 2063,  Expect = 7e-136
 Identities = 305/356 85%, Positives = 331/356 92%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            MVD ATL KLEAGF+KLQ++ D CHSLLKKYLT DVF++LK+KKT MGATLLDVIQSGVE
Sbjct  1    MVDPATLSKLEAGFQKLQNAQD-CHSLLKKYLTRDVFDQLKNKKTDMGATLLDVIQSGVE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDA++Y  FA LF+P+I+ YH GFK TDKHP +DFG+I  +VNVDP NE+
Sbjct  60   NLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPKTDFGNIENFVNVDPKNEY 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            V+STRVRCGRSL GYPFNP LTEAQYKEME KVK QL +FEGELKGTYYPL GMDKATQQ
Sbjct  120  VLSTRVRCGRSLNGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            QLIDDHFLFKEGDRFLQAANACR+WP GRGIFHN  KTFLMWVNEEDHLRIISMQKGGDL
Sbjct  180  QLIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
            KEV+GRLVKAV+HIE+KIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE
Sbjct  240  KEVYGRLVKAVKHIEQKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA +YNLQVRGTAGEHTESVGG+YDISNKRRMGLTEYQAVKEMQDGILELIK+EKS+
Sbjct  300  VAGRYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGILELIKMEKSM 356

Sequence Alignment: 5. Allergen Name: Lit v 2.0101 Sequence ID: Q004B5

 Score = 449.1 bits 1942,  Expect = 1e-127
 Identities = 286/356 80%, Positives = 319/356 89%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            M D A ++KLEAGFKKL+++ D C SLLKKYLT++VF+KLKDK+T +GATLLDVIQSGVE
Sbjct  1    MADAAVIEKLEAGFKKLEAATD-CKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDAEAYTLFA LF+P+IE YH GFK TDKHP  DFGD+N +VNVDP  +F
Sbjct  60   NLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKF 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRSLQGYPFNPCLTE+QYKEME KV + L S+EGELKGTYYPLTGM K  QQ
Sbjct  120  VISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            +LIDDHFLFKEGDRFLQAANACR+WP GRGI+HN +KTFL+WVNEEDHLRIISMQ GGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
             +VF RL  AV  IEK+IPFS  DRLGFLTFCPTNLGTT+RASVHIKLPKLAA+R+KLEE
Sbjct  240  GQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA KYNLQVRGT GEHTE+ GG+YDISNKRRMGLTE+QAVKEMQDGILELIKIEK +
Sbjct  300  VAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 6. Allergen Name: Pro c 2.0101 Sequence ID: H6VGI2

 Score = 444.1 bits 1920,  Expect = 4e-126
 Identities = 282/356 79%, Positives = 318/356 89%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            M D AT+ KLE GFKKL+++ D C SLLKKYL++ +F+ LK KKTG+GATLLDVIQSGVE
Sbjct  1    MADAATIAKLEEGFKKLEAATD-CKSLLKKYLSKSIFDSLKAKKTGLGATLLDVIQSGVE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDAEAY+LFA LF+P+IE YH GFK TDKHP  DFGD+NQ+VNVDP+ +F
Sbjct  60   NLDSGVGIYAPDAEAYSLFAPLFDPIIEDYHKGFKQTDKHPNKDFGDVNQFVNVDPDGKF 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRSL+GYPFNPCLTEAQYKEMEEKV + L  +EGELKGTYYPL GM K  QQ
Sbjct  120  VISTRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTYYPLAGMTKEVQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            +LIDDHFLFKEGDRFLQAANACR+WP GRGI+HN +KTFL+W NEEDHLRIISMQ GGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPVGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
             +V+ RLV AV  IEK++PFS  DRLGFLTFCPTNLGTTIRASVHIKLPKLAA+R+KLEE
Sbjct  240  GQVYRRLVSAVNDIEKRVPFSHHDRLGFLTFCPTNLGTTIRASVHIKLPKLAANREKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VAA+Y+LQVRGT GEHTE+ GGVYDISNKRRMGLTE+QAVKEMQDGILELIKIEK +
Sbjct  300  VAARYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 7. Allergen Name: Scy p 2.0101 Sequence ID: H6VGI3

 Score = 443.9 bits 1919,  Expect = 5e-126
 Identities = 282/356 79%, Positives = 319/356 89%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            M D A ++KLE GFKKL+++ D C SLLKKYLT+ VF++LK KKT +GATLLDVIQSGVE
Sbjct  1    MADAAVIEKLEEGFKKLEAATD-CKSLLKKYLTKSVFDQLKGKKTSLGATLLDVIQSGVE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDAEAYTLFA LF+P+IE YH GFK TDKHP  DFGD+NQ+VNVDP+ +F
Sbjct  60   NLDSGVGVYAPDAEAYTLFAPLFDPIIEDYHKGFKQTDKHPNKDFGDVNQFVNVDPDGKF 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRS++GYPFNPCLTEAQYKEME KV + L ++EGELKGTYYPLTGM K  QQ
Sbjct  120  VISTRVRCGRSMEGYPFNPCLTEAQYKEMESKVSSTLSNLEGELKGTYYPLTGMTKDVQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            +LIDDHFLFKEGDRFLQAANACR+WPTGRGI+HN +KTFL+W NEEDHLRIISMQ GGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPTGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
             +V+ RLV AV  IEK++PFS  DRLGFLTFCPTNLGTT+RASVHIKLPKLAA+R+KLEE
Sbjct  240  GQVYRRLVSAVNEIEKRVPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA KY+LQVRGT GEHTE+ GGVYDISNKRRMGLTE+QAVKEMQDGILELIKIEK +
Sbjct  300  VAGKYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 8. Allergen Name: Pen m 2 Sequence ID: AAO15713

 Score = 441.3 bits 1908,  Expect = 3e-125
 Identities = 280/356 78%, Positives = 317/356 89%, Gaps = 1/356 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            M D A ++KLEAGFKKL+++ D C SLLKKYL++ VF++LK+KKT +GATLLDVIQSGVE
Sbjct  1    MADAAVIEKLEAGFKKLEAATD-CKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVE 59
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDAEAYTLF+ LF+P+IE YH GFK TDKHP  DFGD+N +VNVDP  ++
Sbjct  60   NLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKY 119
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            VISTRVRCGRS++GYPFNPCLTEAQYKEME KV + L S+EGELKGTYYPLTGM K  QQ
Sbjct  120  VISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQ 179
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            +LIDDHFLFKEGDRFLQAANACR+WP GRGI+HN +KTFL+WVNEEDHLRIISMQ GGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDL 239
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
             +VF RL  AV  IEK+IPFS  DRLGFLTFCPTNLGTT RASVHIKLPKLAA+R+KLEE
Sbjct  240  GQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTARASVHIKLPKLAANREKLEE 299
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA KYNLQVRGT GEHTE+ GG+YDISNKRRMGLTE+QAVKEMQDGILELIK+EK +
Sbjct  300  VAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM 356

Sequence Alignment: 9. Allergen Name: Bomb m 1.0101 Sequence ID: ABB88514

 Score = 440.7 bits 1905,  Expect = 5e-125
 Identities = 282/355 79%, Positives = 316/355 89%, Gaps = 2/355 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            MVD ATL+KLEAGF KLQ  G    SLLKKYLT +VF+ LK+KKT  G+TLLD IQSGVE
Sbjct  1    MVDAATLEKLEAGFSKLQ--GSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVE 58
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NLDSGVG+YAPDAE+Y++FA+LF+P+IE YH GFK TDKHPP ++GD++ L N+DP  EF
Sbjct  59   NLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEF 118
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            V+STRVRCGRSL+GYPFNPCLTE+QYKEME+KV   L S+EGELKGT+YPLTGM K TQQ
Sbjct  119  VVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQ 178
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            QLIDDHFLFKEGDRFLQAANACRFWPTGRGI+HN +KTFL+W NEEDHLRIISMQ GGDL
Sbjct  179  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDL 238
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
            ++V+ RLV AV  IEKKIPFS  DRLGFLTFCPTNLGTT+RASVHIKLPKLAAD+KKLEE
Sbjct  239  QQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEE 298
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA+KY+LQVRGT GEHTE+ GGVYDISNKRRMGLTEY AVKEM DGI ELIKIEKSL
Sbjct  299  VASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355

Sequence Alignment: 10. Allergen Name: Plo i 1 Sequence ID: Q95PM9

 Score = 432.0 bits 1867,  Expect = 2e-122
 Identities = 275/355 77%, Positives = 313/355 88%, Gaps = 2/355 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE 60
            MVD ATL+KLEAGF KL +S     SLLKKYLT +VF+ LK+KKT  G+TLLD IQSGVE
Sbjct  1    MVDAATLEKLEAGFSKLAASDS--KSLLKKYLTREVFDALKNKKTSFGSTLLDSIQSGVE 58
Query  61   NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF 120
            NL SGVG+YAPDAEAY +FADLF+P+IE YH GFK TDKHPP ++GD+  L N+DP  EF
Sbjct  59   NLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPPKNWGDVETLGNLDPAGEF 118
Query  121  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ 180
            V+STRVRCGRS++GYPFNPCLTEAQYKEMEEKV + L  +EGELKGT++PLTGM K TQQ
Sbjct  119  VVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTFFPLTGMSKETQQ 178
Query  181  QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL 240
            QLIDDHFLFKEGDRFLQAANACRFWP+GRGI+HN +KTFL+W NEEDHLR+ISMQ GGDL
Sbjct  179  QLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDL 238
Query  241  KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 300
            K+V+ RLV+ V  I K+IPFS ++RLGFLTFCPTNLGTT+RASVHIKLPKLAAD+ KLEE
Sbjct  239  KQVYKRLVRGVNDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEE 298
Query  301  VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            VA+KY+LQVRGT GEHTE+ GGVYDISNKRRMGLTEY+AVKEM DGI ELIKIEKSL
Sbjct  299  VASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIKIEKSL 355

Sequence Alignment: 11. Allergen Name: Bla g 9.0101 Sequence ID: ABC86902

 Score = 426.3 bits 1842,  Expect = 1e-120
 Identities = 274/355 77%, Positives = 309/355 87%, Gaps = 3/355 0%
Query  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTG-MGATLLDVIQSGV 59
            MVD A L+KLEAGF KL +S     SLL+KYLT++VF+ LK KKT   G+TLLDVIQSG+
Sbjct  1    MVDAAVLEKLEAGFAKLAASDS--KSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGL 58
Query  60   ENLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNE 119
            EN DSGVG+YAPDAEAYT+FADLF+P+IE YHGGFK TDKHPP D+GD++ L N+DP  E
Sbjct  59   ENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGE 118
Query  120  FVISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQ 179
            ++ISTRVRCGRS+QGYPFNPCLTEAQYKEME+KV + L  +EGELKG +YPLTGM K  Q
Sbjct  119  YIISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQ 178
Query  180  QQLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGD 239
            Q+LIDDHFLFKEGDRFLQ ANACRFWPTGRGI+HN +KTFL+W NEEDHLRIISMQ GGD
Sbjct  179  QKLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGD 238
Query  240  LKEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLE 299
            L +V+ RLV AV  IEK++PFS DDRLGFLTFCPTNLGTT+RASV IK+PKLAAD+KKLE
Sbjct  239  LGQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLE 298
Query  300  EVAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            EVA KYNLQVRGT GEHTE+ GGVYDISNKRRMGLTEY AVK M DGI ELIKIE SL
Sbjct  299  EVAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356

Sequence Alignment: 12. Allergen Name: Pan h 7.0101 Sequence ID: XP_026780620

 Score = 228.0 bits 972,  Expect = 5e-61
 Identities = 158/327 48%, Positives = 223/327 68%, Gaps = 14/327 4%
Query  28   LKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVEN----LDSGVGLYAPDAEAYTLFADLF 83
            + K L +D++NKL+ K T  G TL D IQ+GV+N    +   VG  A D E Y +F DLF
Sbjct  29   MSKALNKDIYNKLRGKSTPSGFTLDDCIQTGVDNPGHPFIMTVGCVAGDEECYEVFKDLF 88
Query  84   NPVIEGYHGGFKSTDKHPPS-DFGDINQLVNVDPNNEFVISTRVRCGRSLQGYPFNPCLT 142
            +P+I   HGG+K TDKH    ++ ++    ++DPN  +V+S+RVR GRS++GY + P  +
Sbjct  89   DPIISDRHGGYKPTDKHHTDLNWENLKGGDDLDPN--YVLSSRVRTGRSIKGYTLPPHNS 146
Query  143  EAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQQLIDDHFLF-KEGDRFLQAANA 201
              + + +E+     L S++GE+KG YYPL  M +  Q+QLI DHFLF K    +L AA  
Sbjct  147  RGERRAVEKLSIEALTSLDGEFKGKYYPLKDMTEKEQEQLIADHFLFDKPVSPLLLAAGM 206
Query  202  CRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDLKEVFGRLVKAVQHIEKKIP-- 259
             R WP  RGI+HN +KTFL+WVNEEDHLR+ISMQ+GG++KEVF R+   +Q IE+     
Sbjct  207  ARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQQGGNMKEVFRRFCVGLQRIEEIFKKH 266
Query  260  ---FSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEVAAKYNLQVRGTAGEH 316
               F  ++ LGF+  CP+NLGT +R  VH+KLPKL+    K+EE+  +  LQ RGT G  
Sbjct  267  NHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVD 325
Query  317  TESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            T SVGGV+DISN  R+G +E + V+ + DG+  +I++EK L
Sbjct  326  TASVGGVFDISNADRLGSSEVEQVQLVVDGVKLMIEMEKKL 366

Sequence Alignment: 13. Allergen Name: Sal s 7.01 Sequence ID: ACH70914

 Score = 225.7 bits 962,  Expect = 3e-60
 Identities = 154/327 47%, Positives = 224/327 68%, Gaps = 14/327 4%
Query  28   LKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVEN----LDSGVGLYAPDAEAYTLFADLF 83
            + K LT+D++ KL+DK+T  G TL DVIQ+GV+N    +   VG  A D E+Y +F DL+
Sbjct  30   MAKVLTKDMYAKLRDKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEIFKDLL 89
Query  84   NPVIEGYHGGFKSTDKHPPS-DFGDINQLVNVDPNNEFVISTRVRCGRSLQGYPFNPCLT 142
            +P+I   H G+K TDKH    +F ++    ++DPN  +V+S+RVR GRS++GY + P  +
Sbjct  90   DPIISDRHSGYKPTDKHKTDLNFENLKGGDDLDPN--YVLSSRVRTGRSIKGYTLPPHNS 147
Query  143  EAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQQLIDDHFLF-KEGDRFLQAANA 201
              + + +E+     L +++GE+KG YYPL  M  A Q+QLI DHFLF K    +L  A  
Sbjct  148  RGERRAVEKLSVEALNTLDGEFKGKYYPLNKMTDAEQEQLIADHFLFDKPVSPLLLGAGM 207
Query  202  CRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDLKEVFGRLVKAVQHIEKKIP-- 259
             R WP  RGI+HN +K+FL+WVNEEDHLR+ISM+KGG++KEVF R+   ++ IE+     
Sbjct  208  ARDWPDARGIWHNDAKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLKRIEETFKKH 267
Query  260  ---FSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEVAAKYNLQVRGTAGEH 316
               F  ++ LG++  CP+NLGT +R  VH+KLPKL+    K+EE+  +  LQ RGT G  
Sbjct  268  NHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVD 326
Query  317  TESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357
            T SVGGV+DISN  R+G +E   V+ + DG+  ++++EK L
Sbjct  327  TASVGGVFDISNADRLGSSEVDQVQMVVDGVKLMVEMEKKL 367

Sequence Alignment: 14. Allergen Name: Mac r 2.0101 Sequence ID: E2JE77

 Score = 204.5 bits 869,  Expect = 6e-54
 Identities = 150/315 47%, Positives = 208/315 66%, Gaps = 21/315 6%
Query  25   HSLLKKYLTEDVFNKLKDKKTGM-GATLLDVIQSGVENLDSGVGLYAPDAEAYTLFADLF 83
            HSL+ K++T++ + KL   KT   G TL   I   VE  +   G+YA D ++Y  F D+F
Sbjct  12   HSLVAKHVTKERWEKLSGHKTATSGFTLKQAIACAVEFDNQHCGIYAGDWDSYKDFKDVF 71
Query  84   NPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEFVI-STRVRCGRSLQGYPFNPCLT 142
            +P+I+ YHG   S D    SD  ++ + +  + N E  + S R+R GRS+ G+ ++P +T
Sbjct  72   DPIIQEYHG--ISPDAVHTSDM-EVEK-IKGNINAEVPVHSVRIRVGRSIDGFGLSPGIT 127
Query  143  EAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQQLIDDHFLFKEGDRFLQAANAC 202
            + Q   +E  +K+ +  + G+L G YYPLTGMD+  +QQL+DDHFLF  GDR LQ A   
Sbjct  128  KEQRIGVENLMKSAFGKLSGDLAGNYYPLTGMDEKVRQQLVDDHFLFMSGDRNLQVAGME 187
Query  203  RFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDLKEVFGRLVKAVQHI------EK 256
            R WP GRGI+HNA KTFL+WVNEED+LRIISMQ GGD++ VF RL + ++ +      E 
Sbjct  188  RDWPEGRGIYHNAEKTFLVWVNEEDQLRIISMQMGGDVRGVFERLARGIKAVGDSVKAES 247
Query  257  KIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPK-----LAADRKKLEEVAAKYNLQVRG 311
               F  D + GF+  CPTNLGT +RASVH+ LP      L A +K+ EE+     +Q RG
Sbjct  248  GKDFMLDPKYGFVHSCPTNLGTGMRASVHVDLPGWTKEGLDALKKRCEEL----KVQPRG 303
Query  312  TAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGI 347
            T GE     G  YDISNK R+G +E + V+ M DG+
Sbjct  304  TRGESGGQTGHTYDISNKHRLGYSEVELVQCMIDGV 339

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.