The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVICNAIIVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILD
EYWILTAAHCVNGQTASKLSIRYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKL
QSPMTLDQKNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQ
CNKLYEEAGATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKG
YPGVYTRVGSFIDWIDSKRSQ
Sequence Info Allergen Name Length Opt Bits Score E Value
O97370 Eur m 3 261 1758 407.4 2.6e-115
P49275 Der f 3 259 1484 344.9 1.6e-96
P39675 Der p 3 261 1483 344.7 1.9e-96
AAM10779 Blo t 3.0101 266 886 208.6 1.8e-55
ABZ81991 Tyr p 3.0101 285 719 170.5 5.7e-44
AAQ24544 Blo t 6.0101 275 502 121.1 4.2e-29
P49276 Der f 6 279 501 120.8 5.1e-29
AAP57077 Der p 9.0101 273 442 107.4 5.5e-25
AAN02511 Der p 9.0102 261 433 105.3 2.2e-24
P09582 Can f 5.0101 260 385 94.4 4.2e-21
Q7M4I3 Bom p 4.0101 243 344 85.1 2.5e-18
AAP37412 Pol d 4.0101 277 332 82.3 2e-17
AAN02286 Api m 7 405 290 72.6 2.4e-14
3989146 Pol e 4.0101 241 119 33.8 0.0068
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Eur m 3 Sequence ID: O97370

 Score = 407.4 bits 1758,  Expect = 3e-115
 Identities = 261/261 100%, Positives = 261/261 100%, Gaps = 0/261 0%
Query  1    MVICNAIIVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILD 60
            MVICNAIIVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILD
Sbjct  1    MVICNAIIVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILD 60
Query  61   EYWILTAAHCVNGQTASKLSIRYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKL 120
            EYWILTAAHCVNGQTASKLSIRYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKL
Sbjct  61   EYWILTAAHCVNGQTASKLSIRYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKL 120
Query  121  QSPMTLDQKNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQ 180
            QSPMTLDQKNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQ
Sbjct  121  QSPMTLDQKNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQ 180
Query  181  CNKLYEEAGATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKG 240
            CNKLYEEAGATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKG
Sbjct  181  CNKLYEEAGATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKG 240
Query  241  YPGVYTRVGSFIDWIDSKRSQ 261
            YPGVYTRVGSFIDWIDSKRSQ
Sbjct  241  YPGVYTRVGSFIDWIDSKRSQ 261

Sequence Alignment: 2. Allergen Name: Der f 3 Sequence ID: P49275

 Score = 344.9 bits 1484,  Expect = 2e-96
 Identities = 209/254 82%, Positives = 239/254 94%, Gaps = 0/254 0%
Query  8    IVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILDEYWILTA 67
            IV+LLA N LA PILPSSPNATIVGG KA+AG+CPYQISLQSSSHFCGG+ILDEYWILTA
Sbjct  6    IVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSSSHFCGGSILDEYWILTA 65
Query  68   AHCVNGQTASKLSIRYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLD 127
            AHCVNGQ+A KLSIRYN+LKHASGGEK+ VA+IYQHE YDS TIDND+ALIKL++PMTLD
Sbjct  66   AHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIYQHENYDSMTIDNDVALIKLKTPMTLD 125
Query  128  QKNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEE 187
            Q NAK V LP+QGSDVKVGDK+RVSGWGYL+EGSYSLPS++ RVDID+V+REQC++LY +
Sbjct  126  QTNAKPVPLPAQGSDVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSK 185
Query  188  AGATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKGYPGVYTR 247
            AGA +++NMICGG+VA+GGVDSCQGDSGGPVVDVA+ QIVGIVSWGYGCARKGYPGVYTR
Sbjct  186  AGADVSENMICGGDVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTR 245
Query  248  VGSFIDWIDSKRSQ 261
            VG+F+DWI+SKRSQ
Sbjct  246  VGNFVDWIESKRSQ 259

Sequence Alignment: 3. Allergen Name: Der p 3 Sequence ID: P39675

 Score = 344.7 bits 1483,  Expect = 2e-96
 Identities = 213/261 81%, Positives = 244/261 93%, Gaps = 0/261 0%
Query  1    MVICNAIIVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILD 60
            M+I N +IVLLLA NTLANPILP+SPNATIVGG+KA AGECPYQISLQSSSHFCGGTILD
Sbjct  1    MIIYNILIVLLLAINTLANPILPASPNATIVGGEKALAGECPYQISLQSSSHFCGGTILD 60
Query  61   EYWILTAAHCVNGQTASKLSIRYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKL 120
            EYWILTAAHCV GQTASKLSIRYNSLKH+ GGEK+SVA+I+ HEKYDS+ IDNDIALIKL
Sbjct  61   EYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKL 120
Query  121  QSPMTLDQKNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQ 180
            +SPM L+QKNAK+V LP++GSDVKVGD+VRVSGWGYL+EGSYSLPS++ RVDI +V+R++
Sbjct  121  KSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKE 180
Query  181  CNKLYEEAGATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKG 240
            CN+LY +A A +TDNMICGG+VA+GG DSCQGDSGGPVVDV +NQ+VGIVSWGYGCARKG
Sbjct  181  CNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKG 240
Query  241  YPGVYTRVGSFIDWIDSKRSQ 261
            YPGVYTRVG+FIDWI+SKRSQ
Sbjct  241  YPGVYTRVGNFIDWIESKRSQ 261

Sequence Alignment: 4. Allergen Name: Blo t 3.0101 Sequence ID: AAM10779

 Score = 208.6 bits 886,  Expect = 2e-55
 Identities = 126/227 55%, Positives = 163/227 71%, Gaps = 2/227 0%
Query  30   IVGGQKAKAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVNGQTASKLSIRYNSLKHA 89
            IVGG  A  G+ PYQ+SLQ +SHFCGG+I+ + +ILTAAHC+ G +AS L+ RYN+L+H 
Sbjct  36   IVGGSNAADGDAPYQVSLQRTSHFCGGSIIADNYILTAAHCIQGLSASSLTTRYNTLRHN 95
Query  90   SGGEKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLPSQGSDVKVGDKV 149
            SGG  +  ++I  HEKYDS TIDNDIALI+  S M+    NA++++LP QGSD K   +V
Sbjct  96   SGGLTVKASRIIGHEKYDSNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPKASSEV 155
Query  150  RVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMICGGNVADGGVDS 209
             ++GWG L  G+ SLP+ + +V + IV R+ CN  Y   GA ITDNM C G +  GG D+
Sbjct  156  LITGWGTLSSGASSLPTKLQKVTVPIVDRKTCNANYGAVGAEITDNMFCAGILNVGGKDA 215
Query  210  CQGDSGGPVVDVASNQIVGIVSWGYGCARKGYPGVYTRVGSFIDWIDSK 258
            CQGDSGGPV   A+  +VG VSWGYGCA+  YPGVYTRVG++I WI  K
Sbjct  216  CQGDSGGPVA--ANGVLVGAVSWGYGCAQAKYPGVYTRVGNYISWIKGK 262

Sequence Alignment: 5. Allergen Name: Tyr p 3.0101 Sequence ID: ABZ81991

 Score = 170.5 bits 719,  Expect = 6e-44
 Identities = 107/227 47%, Positives = 154/227 67%, Gaps = 8/227 3%
Query  25   SPNATIVGGQKAKAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVNGQTASK---LSI 81
            S N  IVGG +A  G+ P+Q+SLQ +SHFCGG+I+ E WILTAAHC++    S    +S+
Sbjct  29   SQNGFIVGGTEAVDGDAPHQVSLQHTSHFCGGSIISERWILTAAHCIDADDLSNPGGMSV 88
Query  82   RYNSLKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLPSQGS 141
            RYN+L   SG   + V  I  HE+Y + T DNDIAL++  + M L+Q NA + +LP++G+
Sbjct  89   RYNTLNLKSG-TLVKVKSIKVHEQYSNVTSDNDIALLETVASMNLNQTNAVAAKLPAKGN 147
Query  142  DVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMICGGN 201
            D + GD + +SGWG L  G  ++P+++ +V + +  R  C + Y      IT+NM C G 
Sbjct  148  DPQDGD-LFLSGWGTLHSGDTTIPTNLQKVTVPLTNRSVCAEAYTGI-VNITENMFCAGK 205
Query  202  VADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKGYPGVYTRVGSFIDWID 256
            +  GGVDSCQGDSGG  +   + ++VG+VS+G GC    YPGVYTRV  ++DWI+
Sbjct  206  MGIGGVDSCQGDSGGGAM--LNKELVGVVSFGVGCGDPKYPGVYTRVSQYLDWIE 258

Sequence Alignment: 6. Allergen Name: Blo t 6.0101 Sequence ID: AAQ24544

 Score = 121.1 bits 502,  Expect = 4e-29
 Identities = 88/225 39%, Positives = 138/225 61%, Gaps = 18/225 8%
Query  24   SSPNATIVGGQKAKAGECPYQISLQSS-----SHFCGGTILDEYWILTAAHCVNGQTASK 78
            +SP   +VGG  AK  E P+QISL        SH CGG+++    ++TAAHC +GQTAS 
Sbjct  43   NSP--RVVGGTDAKKAEAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASS 100
Query  79   LSIRYNSLKHASGG-EKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLP 137
            L  R  + + +  G   +   +I QHE+YD  TI+NDI+L+ L SP+T      K + + 
Sbjct  101  LINRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPIT-PSDTVKVIAI- 158
Query  138  SQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMI 197
             + +++  G+ V++ GWG     +  LP ++   ++ IV++E+CN  + E   TI   MI
Sbjct  159  -EETNLNGGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVN-TIKPGMI 216
Query  198  CGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYG-CARKGYPGVYTRVGSFIDWID 256
            C   +A     +C GDSGGP+  V + ++ GIVSWG   C    Y  V+TR   +++WI+
Sbjct  217  CA--LAPS-TQACNGDSGGPL--VYNGKLAGIVSWGPSKCPVGEYMAVFTRPNHYLEWIN 271
Query  257  SKR 259
            + +
Sbjct  272  ANK 274

Sequence Alignment: 7. Allergen Name: Der f 6 Sequence ID: P49276

 Score = 120.8 bits 501,  Expect = 5e-29
 Identities = 89/233 38%, Positives = 128/233 54%, Gaps = 15/233 6%
Query  15   NTLANPILPSSPNATIVGGQKAKAGECPYQISLQSS-----SHFCGGTILDEYWILTAAH 69
            N +    +  SP A +VGGQ A   E P+QISL         H CGG+++ E  ++TAAH
Sbjct  35   NEFPRSKIGDSPIAGVVGGQDADLAEAPFQISLLKDYLIMKRHMCGGSLISESTVVTAAH 94
Query  70   CVNGQTASKLSIRYNSLKHASGGE-KLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQ 128
            C  GQ AS LS+RY + +  S     L V  I QHE Y+      D  +I L +P+ +  
Sbjct  95   CTYGQKASSLSVRYGTNQRTSSSYGDLKVKPIIQHESYEQDQTQTDKTIIILPNPV-VPS 153
Query  129  KNAKSVQLPSQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEA 188
             N +  ++ ++  D+  GDKV + GWG        LP  + +  + IV  ++CN+ +   
Sbjct  154  TNVQMNEIETE--DIVDGDKVTIYGWGLTDGNGKDLPDKLQKGSMTIVGNDRCNEKWGSI 211
Query  189  GATITDNMICGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYG-CARKGYPGVYTR 247
             A I   MIC  +    G   C GDSGGP+V  A+ ++ GIVSWG   C    Y  V+TR
Sbjct  212  NA-IHPGMICALDKTQSG---CNGDSGGPLVS-ANRKLTGIVSWGPSKCPPGEYMSVFTR 266
Query  248  VGSFIDWI 255
               ++DWI
Sbjct  267  PKYYLDWI 274

Sequence Alignment: 8. Allergen Name: Der p 9.0101 Sequence ID: AAP57077

 Score = 107.4 bits 442,  Expect = 5e-25
 Identities = 87/217 40%, Positives = 133/217 61%, Gaps = 15/217 6%
Query  30   IVGGQKAKAGECPYQISL-QSSSHFCGGTILDEYWILTAAHCVNGQTA--SKLSIRYNSL 86
            IVGG  A  G+  YQI+L +  S  CGG+++    +LTAAHCV G  A  S + IRYN+L
Sbjct  50   IVGGSNASPGDAVYQIALFRKDSFTCGGSLISSRTVLTAAHCVFGDEATPSYFKIRYNTL 109
Query  87   KHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLPSQGSDVKVG 146
               + G  + V++IY+H  Y S  ID D+A + L  P T    +A +  +P   S+   G
Sbjct  110  DR-TNGPPIGVSKIYRHNLYSSSPIDYDVATLILSQPFT---PSANADIIPLTTSEPADG 165
Query  147  DKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMICGGNVADGG 206
             K++++GWG LK G  +LP+ +    +  ++R +C+  +    A IT+ M+C  N     
Sbjct  166  TKLQITGWGRLKSGG-TLPTILQIASVTKMSRTKCSSTWGSVNA-ITNRMLCAHNSNQA- 222
Query  207  VDSCQGDSGGPVVDVASNQIVGIVSWGYG-CARKGYPGVYTRVGSFIDWIDS 257
              SC GDSGGP+V  ++ ++VG+VSWG   C    YP +Y+ V ++ +WI S
Sbjct  223  --SCNGDSGGPLV--SNGHLVGVVSWGPSTCLSTKYPTIYSNVANLRNWIIS 270

Sequence Alignment: 9. Allergen Name: Der p 9.0102 Sequence ID: AAN02511

 Score = 105.3 bits 433,  Expect = 2e-24
 Identities = 78/194 40%, Positives = 116/194 59%, Gaps = 13/194 6%
Query  30   IVGGQKAKAGECPYQISL-QSSSHFCGGTILDEYWILTAAHCVNGQTA--SKLSIRYNSL 86
            IVGG  A  G+  YQI+L +  S  CGG+++    +LTAAHCV G  A  S + IRYN+L
Sbjct  64   IVGGSNASPGDAVYQIALFRKDSFTCGGSLISSRTVLTAAHCVFGDEATPSYFKIRYNTL 123
Query  87   KHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLPSQGSDVKVG 146
               + G  + V++IY+H  Y S TID D+A + L  P T    +A +  +P   S+   G
Sbjct  124  DR-TNGPTIGVSKIYRHNLYSSSTIDYDVATLILSQPFT---PSANADIIPLTTSEPADG 179
Query  147  DKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMICGGNVADGG 206
             K++++GWG LK G  +LP+ +    +  ++R +C+  +    A IT+ M+C  N     
Sbjct  180  TKLQITGWGRLKSGG-TLPTILQIASVTKMSRTKCSSTWGSVNA-ITNRMLCAHNSKQA- 236
Query  207  VDSCQGDSGGPVVDVASNQIVGIVSWG 233
              SC GDSGGP+V    + + G  SWG
Sbjct  237  --SCNGDSGGPLVS-NGHLVGGKFSWG 260

Sequence Alignment: 10. Allergen Name: Can f 5.0101 Sequence ID: P09582

 Score = 94.4 bits 385,  Expect = 4e-21
 Identities = 72/216 33%, Positives = 121/216 56%, Gaps = 22/216 10%
Query  30   IVGGQKAKAGECPYQISLQSSSHF-CGGTILDEYWILTAAHCVNGQTASKLSIRYNSLKH 88
            I+GG++      P+Q+++  +  F CGG +++  W+LTAAHC N      L  R+N  + 
Sbjct  25   IIGGRECLKNSQPWQVAVYHNGEFACGGVLVNPEWVLTAAHCANSNCEVWLG-RHNLSES 83
Query  89   ASGGEKLSVAQIYQHEKYDSWTI----------DNDIALIKLQSPMTLDQKNAKSVQLPS 138
               G+ + V + + H  Y +              +D+ L+ L+ P  +  K  + + LP 
Sbjct  84   EDEGQLVQVRKSFIHPLYKTKVPRAVIRPGEDRSHDLMLLHLEEPAKIT-KAVRVMDLPK 142
Query  139  QGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMIC 198
            +  +  +G    VSGWG     +   P  +  VD+ +++  QC K+Y +    +T  M+C
Sbjct  143  K--EPPLGSTCYVSGWGSTDPETIFHPGSLQCVDLKLLSNNQCAKVYTQK---VTKFMLC 197
Query  199  GGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYG-CARKGYPGVYTRVGSFIDWI 255
             G V +G  D+C+GDSGGP++     ++VGI SWG   C +   P +YTRV   + WI
Sbjct  198  AG-VLEGKKDTCKGDSGGPLI--CDGELVGITSWGATPCGKPQMPSLYTRVMPHLMWI 252

Sequence Alignment: 11. Allergen Name: Bom p 4.0101 Sequence ID: Q7M4I3

 Score = 85.1 bits 344,  Expect = 3e-18
 Identities = 77/215 35%, Positives = 127/215 59%, Gaps = 28/215 13%
Query  30   IVGGQKAKAGECPYQISL---------QSSSHFCGGTILDEYWILTAAHCVNGQTASKLS 80
            +VGG+ AK G  P+ ++L         +S    CGG++     +LTAAHC   ++   + 
Sbjct  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
Query  81   IRYNSLKHASGGE---KLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLP 137
            I   +LK    G    ++ +     H  Y      +DIA++KL+  +++ +   + + LP
Sbjct  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEY-IRPICLP 119
Query  138  SQGS---DVKVGDKVRVSGWGYLKEGSYSLP-SD-MYRVDIDIVAREQCNKLYEEAGATI 192
             + S   +  +G    V+GWG L+   Y  P SD +  V + +V  + C + Y +    +
Sbjct  120  IEESLRNNNFIGYNPFVAGWGRLR---YKGPLSDALMEVQVPVVRNKVCKRAYSD----V 172
Query  193  TDNMICGGNVADGGVDSCQGDSGGPVV--DVASNQIVGIVSWGYGCARKGYPGVYTRVGS 250
            +D +IC G    G  DSCQGDSGGP++    ++   +G+VS+G+ CA   YPGVYTRV S
Sbjct  173  SDTVICAG-YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTS 231
Query  251  FID 253
            ++D
Sbjct  232  YLD 234

Sequence Alignment: 12. Allergen Name: Pol d 4.0101 Sequence ID: AAP37412

 Score = 82.3 bits 332,  Expect = 2e-17
 Identities = 81/240 33%, Positives = 131/240 54%, Gaps = 34/240 14%
Query  4    CNAIIVLLLAFNTLANPILPS------SPNATIVGGQKAKAGECPYQISL--QSSSHFCG 55
            C  II+L++    +A     +      +P+  IV G + +  E P    L   S   +CG
Sbjct  3    CGKIILLFITIIGVAKSREENCKCGWDNPS-RIVNGVETEINEFPMVARLIYPSPGMYCG 61
Query  56   GTILDEYWILTAAHCVNGQTASKLS-IR-------YNSLKHASGGEKLSVAQIYQHEKYD 107
            GTI+    I+TAAHC+     +  + I        Y +    +  ++ ++A++  H  Y+
Sbjct  62   GTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYN 121
Query  108  SWTIDNDIALIKLQSPMTLDQKNAKSVQLP-SQGSDVKVGDKVRVSGWGYLKEGSYSLPS 166
            S   +NDIA++K         K    V LP +  +     + V   GWG L+    +   
Sbjct  122  SH--NNDIAIVKTNERFEYSMK-VGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQN-SK 177
Query  167  DMYRVDIDIVAREQCNKLYEEAGATITD-NMICGGNVADGGVDSCQGDSGGPVV---DVA 222
             + +VD+ ++ REQC   Y   GA I + N++C  +V   G D+CQ DSGGP++      
Sbjct  178  VLRKVDLHVITREQCETHY---GAAIANANLLCTFDV---GRDACQNDSGGPILWRSPTT 231
Query  223  SNQI-VGIVSWGYGCARKGYPGVYTRVGSFIDWI 255
             N I VG+V++G  CA    PG   RV SF+++I
Sbjct  232  DNLILVGVVNFGRTCADDA-PGGNARVTSFMEFI 264

Sequence Alignment: 13. Allergen Name: Api m 7 Sequence ID: AAN02286

 Score = 72.6 bits 290,  Expect = 2e-14
 Identities = 81/217 37%, Positives = 122/217 56%, Gaps = 30/217 13%
Query  30   IVGGQKAKAGECPYQISLQSS---SHFCGGTILDEYWILTAAHCVNGQTASKLSIRYN-- 84
            IVGG      E P    ++ +      CG TI+ + ++LTAAHC+  +  +KL+I     
Sbjct  161  IVGGTNTGINEFPMMAGIKRTYEPGMICGATIISKRYVLTAAHCIIDENTTKLAIVVGEH 220
Query  85   --SLKHASGGEKL-SVAQIYQHEKYD-----SWTIDNDIALIKLQSPMTLDQKNAKSVQL 136
              S K  +    L S+ ++  H KYD      W I NDIAL+K +  + +  K   +  L
Sbjct  221  DWSSKTETNATVLHSINKVIIHPKYDIIEKDDWQI-NDIALLKTEKDIKFGDKVGPAC-L 278
Query  137  PSQGS-DVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDN 195
            P Q   D   G  V V GWG+       L   + +  ++++ + +C K Y      I  N
Sbjct  279  PFQHFLDSFAGSDVTVLGWGHTSFNGM-LSHILQKTTLNMLTQVECYKYY----GNIMVN 333
Query  196  MICGGNVADGGVDSCQGDSGGPVV--DVASNQIV--GIVSWGYGCARKGYPGVYTRVGSF 251
             +C       G D+CQ DSGGPV+  +  + ++V  GI+SWG  C +  YP   T+VGS+
Sbjct  334  AMCAYA---KGKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECGK--YPNGNTKVGSY 388
Query  252  IDWIDSK 258
            IDWI S+
Sbjct  389  IDWIVSQ 395

Sequence Alignment: 14. Allergen Name: Pol e 4.0101 Sequence ID: 3989146

 Score = 33.8 bits 119,  Expect = 0.007
 Identities = 36/122 29%, Positives = 52/122 42%, Gaps = 10/122 8%
Query  30   IVGGQKAKAGECPYQISL--QSSSHFCGGTILDEYW--ILTAAHCVNGQTASKLSIRYNS 85
            +V G +    E P    L       +CGGTI+   +  ILTAAHCV G     L    ++
Sbjct  1    LVNGVETGINEFPMMARLIYXXXXFYCGGTIITPPFKHILTAAHCVEGFLDPTLXXXXST 60
Query  86   LKHASGGEKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLPSQGSDVKV 145
                         ++  H  Y  +  DNDI+++ L             V LP    + +V
Sbjct  61   TGETYDLSXXYTIKVTIHPNY--FDHDNDISIV-LXXXXXXXXXXVGPVCLPFNYMN-RV 116
Query  146  GDKVRVS--GWG 155
               V V+  GWG
Sbjct  117  FTDVTVTALGWG 128

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.