The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI
RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL
QNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY
Sequence Info Allergen Name Length Opt Bits Score E Value
B4XID4 Ara h 7.0201 164 1160 143.3 3.2e-36
AAD56719 Ara h 7 160 834 106.3 4.2e-25
Q9SQH1 Ara h 7.0101 160 834 106.3 4.2e-25
AAK96887 Ara h 2.0101 156 507 69.2 6.1e-14
ACN62248 Ara h 2.0101 157 494 67.7 1.7e-13
AAN77576 Ara h 2.0201 172 390 55.9 6.6e-10
AAD56337 Ara h 6 129 306 46.4 3.7e-07
AAK15088 Ses i 1 153 218 36.4 0.00045
P01089 Ric c 1 258 198 34.2 0.0035
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 7.0201 Sequence ID: B4XID4

 Score = 143.3 bits 1160,  Expect = 3e-36
 Identities = 164/164 100%, Positives = 164/164 100%, Gaps = 0/164 0%
Query  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
            MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI
Sbjct  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
Query  61   RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL 120
            RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL
Sbjct  61   RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL 120
Query  121  QNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY 164
            QNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY
Sbjct  121  QNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY 164

Sequence Alignment: 2. Allergen Name: Ara h 7 Sequence ID: AAD56719

 Score = 106.3 bits 834,  Expect = 4e-25
 Identities = 117/125 93%, Positives = 124/125 99%, Gaps = 0/125 0%
Query  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
            MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH+
Sbjct  2    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHM 61
Query  61   RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL 120
            R+RVE+EQEQEQDEYPY +RGSRG++PGESDE+QEQRCCNELNRFQNNQRCMCQALQQIL
Sbjct  62   RRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQIL 121
Query  121  QNQSF 125
            QNQSF
Sbjct  122  QNQSF 126

Sequence Alignment: 3. Allergen Name: Ara h 7.0101 Sequence ID: Q9SQH1

 Score = 106.3 bits 834,  Expect = 4e-25
 Identities = 117/125 93%, Positives = 124/125 99%, Gaps = 0/125 0%
Query  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
            MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH+
Sbjct  2    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHM 61
Query  61   RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL 120
            R+RVE+EQEQEQDEYPY +RGSRG++PGESDE+QEQRCCNELNRFQNNQRCMCQALQQIL
Sbjct  62   RRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQIL 121
Query  121  QNQSF 125
            QNQSF
Sbjct  122  QNQSF 126

Sequence Alignment: 4. Allergen Name: Ara h 2.0101 Sequence ID: AAK96887

 Score = 69.2 bits 507,  Expect = 6e-14
 Identities = 80/146 54%, Positives = 112/146 76%, Gaps = 16/146 10%
Query  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
            M KL+ILVAL  AL+++A+         S   +W+   +GD +CQ QL+RANLRPCE+H+
Sbjct  1    MAKLTILVAL--ALFLLAA-------HASARQQWEL--QGDRRCQSQLERANLRPCEQHL 49
Query  61   RQRVEKEQEQ-EQDEYPYIQ---RGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQAL 116
             Q+++++++  E+D Y   Q     S   R G     +++RCCNELN F+NNQRCMC+AL
Sbjct  50   MQKIQRDEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEAL 109
Query  117  QQILQNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDL 158
            QQI++NQS R+Q  R Q +Q +RELRNLPQ CG+R+P RCDL
Sbjct  110  QQIMENQSDRLQ-GRQQEQQFKRELRNLPQQCGLRAPQRCDL 150

Sequence Alignment: 5. Allergen Name: Ara h 2.0101 Sequence ID: ACN62248

 Score = 67.7 bits 494,  Expect = 2e-13
 Identities = 79/141 56%, Positives = 111/141 78%, Gaps = 20/141 14%
Query  4    LSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHIRQR 63
            L+ILVAL  AL+++A+         S   +W+   +GD +CQ QL+RANLRPCE+H+ Q+
Sbjct  1    LTILVAL--ALFLLAA-------HASARQQWEL--QGDRRCQSQLERANLRPCEQHLMQK 49
Query  64   VEKEQEQ-EQDEY-----PYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQ 117
            ++++++  E+D Y     PY    S   R G     +++RCCNELN F+NNQRCMC+ALQ
Sbjct  50   IQRDEDSYERDPYSPSQDPY--SPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQ 107
Query  118  QILQNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDL 158
            QI++NQS R+Q  R Q +Q +RELRNLPQ CG+R+P RCDL
Sbjct  108  QIMENQSDRLQ-GRQQEQQFKRELRNLPQQCGLRAPQRCDL 147

Sequence Alignment: 6. Allergen Name: Ara h 2.0201 Sequence ID: AAN77576

 Score = 55.9 bits 390,  Expect = 7e-10
 Identities = 80/146 54%, Positives = 111/146 76%, Gaps = 28/146 19%
Query  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
            M KL+ILVAL  AL+++A+         S   +W+   +GD +CQ QL+RANLRPCE+H+
Sbjct  1    MAKLTILVAL--ALFLLAA-------HASARQQWEL--QGDRRCQSQLERANLRPCEQHL 49
Query  61   RQRVEKEQEQ--------EQDEYPYIQRGSRGQ--------RPGESDEDQEQRCCNELNR 104
             Q+++++++          QD Y   Q   R          R G     +++RCCNELN 
Sbjct  50   MQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNE 109
Query  105  FQNNQRCMCQALQQILQNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDL 158
            F+NNQRCMC+ALQQI++NQS R+Q  R Q +Q +RELRNLPQ CG+R+P RCDL
Sbjct  110  FENNQRCMCEALQQIMENQSDRLQ-GRQQEQQFKRELRNLPQQCGLRAPQRCDL 162

Sequence Alignment: 7. Allergen Name: Ara h 6 Sequence ID: AAD56337

 Score = 46.4 bits 306,  Expect = 4e-07
 Identities = 64/116 55%, Positives = 84/116 72%, Gaps = 16/116 13%
Query  27   RGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHIRQRVEKEQEQEQDEYPYIQRGSRGQR 86
            R  RG + D+ S     C+RQ+   NL+PCE+HI QR+  EQEQ  D Y +   GS    
Sbjct  7    RRERGRQGDSSS-----CERQVDGVNLKPCEQHIMQRIMGEQEQ-YDSYNF---GST--- 54
Query  87   PGESDEDQEQRCCNELNRFQNNQRCMCQALQQILQNQSFRFQQDRSQLHQMERELRNLPQ 146
                  DQ+QRCC+ELN  +N QRCMC+ALQQI++NQ   +Q DR  +++ +REL NLPQ
Sbjct  55   ---RSSDQQQRCCDELNEMENTQRCMCEALQQIMENQCDGLQ-DRQMVQHFKRELMNLPQ 110
Query  147  NCGFRSPSRCDL 158
             C F +P RCDL
Sbjct  111  QCNFGAPQRCDL 122

Sequence Alignment: 8. Allergen Name: Ses i 1 Sequence ID: AAK15088

 Score = 36.4 bits 218,  Expect = 0.0004
 Identities = 46/143 32%, Positives = 82/143 57%, Gaps = 15/143 10%
Query  3    KLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHIRQ 62
            KL++   LL A++ +ASAT +     +     D  ++   QC++QLQ   +R C+ ++ Q
Sbjct  4    KLALAAVLLVAMVALASATTYTTTVTTTAID-DEANQQSQQCRQQLQGRQFRSCQRYLSQ 62
Query  63   RVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL-- 120
                    E+DE   +  G+  Q+  +S  D    CC +L     ++RC C+A++Q +  
Sbjct  63   G-RSPYGGEEDEVLEMSTGN--QQSEQSLRD----CCQQLRNV--DERCRCEAIRQAVRQ 113
Query  121  QNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDL 158
            Q Q   +Q+ +SQ  Q+ +  R+LP+ C  R P +C +
Sbjct  114  QQQEGGYQEGQSQ--QVYQRARDLPRRCNMR-PQQCQF 148

Sequence Alignment: 9. Allergen Name: Ric c 1 Sequence ID: P01089

 Score = 34.2 bits 198,  Expect = 0.004
 Identities = 37/106 34%, Positives = 62/106 58%, Gaps = 11/106 10%
Query  43   QCQRQLQRANLRPCEEHIRQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQR---CC 99
            +C RQ  R N  P ++  R +++++Q   Q +  YI++   GQ P  SD +QE+    CC
Sbjct  148  RCMRQT-RTN--PSQQGCRGQIQEQQNLRQCQ-EYIKQQVSGQGPRRSD-NQERSLRGCC 202
Query  100  NELNRFQNNQRCMCQALQQILQNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRC 156
            + L + Q+  +C C+ L+Q ++ Q  + Q     + +  R   NLP  CG  SP+ C
Sbjct  203  DHLKQMQS--QCRCEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGV-SPTEC 256

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.