The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR
NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL
VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE
AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL
TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE
GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI
IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK
KLIKKQSESQFVDAQPEQQEREEARKGGKGPFVY
Sequence Info Allergen Name Length Opt Bits Score E Value
B1NPN8 Vig r 2.0201 454 2955 679.9 7.3e-197
Q198W3 Vig r 2.0101 453 2470 569.3 1.4e-163
Q9FZP9 Gly m 5.0201 559 1925 445.0 4.4e-126
AAB23463 Gly m conglycinin 439 1882 435.3 3e-123
O22120 Gly m 5.0101 543 1880 434.8 5.2e-123
CAA35691 Gly m conglycinin 605 1880 434.8 5.9e-123
AAB01374 Gly m conglycinin 639 1429 332.0 5.5e-92
ACB05815 Lup an 1.0101 611 1226 285.7 4.5e-78
CAD87730 Len c 1.0101 418 1170 273.0 2e-74
CAD87731 Len c 1.0102 415 1166 272.1 3.8e-74
CAF25232 Pis s 1.0101 415 1141 266.4 2e-72
CAF25233 Pis s 1.0102 415 1124 262.5 2.9e-71
AAA33947 Gly m conglycinin 218 982 230.4 6.9e-62
Q9SPL4 Mac i 1.0201 666 904 212.3 6.1e-56
AAM54366 Jug n 2 481 900 211.4 8e-56
Q9SPL3 Mac i 1.0101 625 901 211.6 9.2e-56
AAF18269 Jug r 2 593 892 209.6 3.6e-55
B3STU4 Car i 2.0101 792 891 209.3 5.8e-55
P09801 Gos h 1 588 829 195.2 7.5e-51
P09799 Gos h 2 605 823 193.8 2e-50
P43237 Ara h 1 614 767 181.1 1.4e-46
P43238 Ara h 1 626 660 156.7 3.2e-39
A0A2I4E5L6 Jug r 6.0101 502 540 129.4 4.2e-31
V9VGU0 Pin k 2.0101 463 509 122.3 5.2e-29
AAK15089 Ses i 3 585 474 114.3 1.7e-26
AAL86739 Cor a 11 448 404 98.4 8e-22
EF116865 Pis v 3.0101 519 388 94.7 1.2e-20
AAM73729 Ana o 1.0102 536 349 85.8 5.8e-18
AAM73730 Ana o 1.0101 538 348 85.6 6.9e-18
A0A0S3B0K0 Coc n 1.0101 490 220 56.4 3.7e-09
BAB21619 Gly m Bd28K 473 201 52.1 7.2e-08
P13744 Cuc ma 4.0101 480 187 48.9 6.7e-07
DQ631677 Pis v 2.0201 472 158 42.3 6.4e-05
DQ631676 Pis v 2.0101 496 141 38.4 0.001
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 679.9 bits 2955,  Expect = 7e-197
 Identities = 454/454 100%, Positives = 454/454 100%, Gaps = 0/454 0%
Query  1    MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR 60
            MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR
Sbjct  1    MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR 60
Query  61   NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL 120
            NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL
Sbjct  61   NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL 120
Query  121  VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE 180
            VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE
Sbjct  121  VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE 180
Query  181  AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL 240
            AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL
Sbjct  181  AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL 240
Query  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
            TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE
Sbjct  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
Query  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
            GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI
Sbjct  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
Query  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
            IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK
Sbjct  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
Query  421  KLIKKQSESQFVDAQPEQQEREEARKGGKGPFVY 454
            KLIKKQSESQFVDAQPEQQEREEARKGGKGPFVY
Sbjct  421  KLIKKQSESQFVDAQPEQQEREEARKGGKGPFVY 454

Sequence Alignment: 2. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 569.3 bits 2470,  Expect = 1e-163
 Identities = 380/443 85%, Positives = 417/443 94%, Gaps = 7/443 1%
Query  1    MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR 60
            MVRAR+ LLL  GILFLASLSVSFGIVHRE+ +  E S SRG+NNPFYFNSDR FHTLF+
Sbjct  1    MVRARVQLLL--GILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFK 58
Query  61   NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL 120
            NQ+GHLRV++RFDQRSKQ+QNLENYRVVE+ SKPNTLLLPHHADADFLLVVLNGRA+LTL
Sbjct  59   NQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTL 118
Query  121  VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE 180
            VNPDGRDS ILEQGHAQKIPAGTTFFLVNP+DN+NLRIIKLA+PVNNPHRFQ+FFLSSTE
Sbjct  119  VNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTE 178
Query  181  AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL 240
            AQQSYL+GFSKNILEASFDSD KEI RVLFGEE +QQQ+G+ESQ+EGVIVELKREQIREL
Sbjct  179  AQQSYLRGFSKNILEASFDSDFKEIDRVLFGEE-RQQQHGEESQEEGVIVELKREQIREL 237
Query  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
             KHAKSSS+K LSS+D+PFNLRN  PIYSNK+GRW+EITPEKNPQL+DLD+FI SVDMKE
Sbjct  238  IKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKE 297
Query  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
            G LLLPHYNSKAIVILVINEG+A IELVG  +QQ+Q    +ES EVQRYRAELSEDDVF+
Sbjct  298  GGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYRAELSEDDVFV 353
Query  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
            IPA YPVAINATSNLNFFAFGINAENNQRNFLAGEKDNV+SEIPTEVLDV+FPASG KV+
Sbjct  354  IPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVE 413
Query  421  KLIKKQSESQFVDAQPEQQEREEARKGGKG 450
            KLIKKQSES+FVDAQPEQQ+REE  KG KG
Sbjct  414  KLIKKQSESHFVDAQPEQQQREEGHKGRKG 443

Sequence Alignment: 3. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 445.0 bits 1925,  Expect = 4e-126
 Identities = 283/408 69%, Positives = 361/408 88%, Gaps = 5/408 1%
Query  41   RGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLL 99
            R KN NPF+FNS R F+TLF+NQ+GH+RVLQRF++RS+Q+QNL +YR++E+ SKPNTLLL
Sbjct  143  RHKNKNPFHFNSKR-FQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 201
Query  100  PHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRII 159
            PHHADAD+L+V+LNG A+LTLVN D RDS  L+ G A ++PAGTT+++VNPD++ENLR+I
Sbjct  202  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMI 261
Query  160  KLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQ 219
             LA+PVN P RF+ FFLSST+AQQSYLQGFSKNILEAS+D+  +EI++VLFG E + QQQ
Sbjct  262  TLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGRE-EGQQQ 320
Query  220  GQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEIT 279
            G+E  QE VIVE+ ++QIREL+KHAKSSS+K++SSED+PFNLR++ PIYSNKLG+ FEIT
Sbjct  321  GEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEIT 380
Query  280  PEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEE 339
            PEKNPQLRDLD+F+  VDM EG+L+LPH+NSKAIV+LVINEG+ANIELVG +EQQ++Q++
Sbjct  381  PEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQ 440
Query  340  QEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNV 399
            +E+  EV++YRAELSE D+F+IPA YPV +NATS+LNFFAFGINAENNQRNFLAG KDNV
Sbjct  441  EEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNV 500
Query  400  ISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARKGGKGPF 452
            IS+IP++V ++ FP S + ++ LIK QSES FVDAQP  Q++EE  KG KGP+
Sbjct  501  ISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEEGNKGRKGPL 551

Sequence Alignment: 4. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 435.3 bits 1882,  Expect = 3e-123
 Identities = 298/431 69%, Positives = 372/431 86%, Gaps = 21/431 4%
Query  1    MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR 60
            M+R R PLL+LLG +FLAS+ VS+ +  RE+           +NNPFYF S   F+TLF 
Sbjct  1    MMRVRFPLLVLLGTVFLASVCVSLKV--RED-----------ENNPFYFRSSNSFQTLFE 47
Query  61   NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL 120
            NQ   +R+LQRF++RS Q++NL +YR+V++ SKPNT+LLPHHADADFLL VL+GRA+LTL
Sbjct  48   NQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTL 107
Query  121  VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE 180
            VN D RDS  L  G AQ+IPAGTT++LVNP D++NL+IIKLA+PVN P R+ DFFLSST+
Sbjct  108  VNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQ 167
Query  181  AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL 240
            AQQSYLQGFS NILE SF S+ +EI+RVLFGEE +Q+QQ      EGVIVEL +EQIR+L
Sbjct  168  AQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ------EGVIVELSKEQIRQL 221
Query  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
            ++ AKSSS+K++SSED+PFNLR++ PIYSN +G++FEITPEKNPQLRDLD+F+ SVD+ E
Sbjct  222  SRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINE 281
Query  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
            G+LLLPH+NSKAIVILVINEG ANIELVG +EQQ++Q+++EE  EVQRYRAELSEDDVF+
Sbjct  282  GALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFV 341
Query  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
            IPA YP  +NATSNLNF+AFGINAENNQRNFLAGEKDNV+ +I  +V ++ FP S + V+
Sbjct  342  IPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE 401
Query  421  KLIKKQSESQFVDAQPEQQEREEARKGGKGPF 452
            +L+KKQ ES FVDAQP+Q  +EE  KG KGPF
Sbjct  402  RLLKKQRESYFVDAQPQQ--KEEGSKGRKGPF 431

Sequence Alignment: 5. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 434.8 bits 1880,  Expect = 5e-123
 Identities = 279/421 66%, Positives = 360/421 85%, Gaps = 5/421 1%
Query  28   HRENIDGAEVSVSRGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYR 86
            +RE+ +  +  + R KN NPF F S+R F TLF+NQ+G +RVLQRF+QRS Q+QNL +YR
Sbjct  114  QRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 172
Query  87   VVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFF 146
            ++E+ SKPNTLLLP+HADAD+L+V+LNG A+L+LVN D RDS  L+ G A ++P+GTT++
Sbjct  173  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 232
Query  147  LVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEIS 206
            +VNPD+NENLR+I LA+PVN P RF+ FFLSSTEAQQSYLQGFS+NILEAS+D+  +EI+
Sbjct  233  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 292
Query  207  RVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKP 266
            +VLF  E + QQQG++  QE VIVE+ +EQIR L+K AKSSS+K++SSED+PFNLR++ P
Sbjct  293  KVLFSRE-EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDP 351
Query  267  IYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIE 326
            IYSNKLG++FEITPEKNPQLRDLD+F+  VDM EG+LLLPH+NSKAIVILVINEG ANIE
Sbjct  352  IYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIE 411
Query  327  LVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAEN 386
            LVG +EQQ++Q+++E+  EV++YRAELSE D+F+IPA YPV +NATSNLNFFA GINAEN
Sbjct  412  LVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 471
Query  387  NQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARK 446
            NQRNFLAG +DNVIS+IP++V ++ FP S + V+KL+K Q ES FVDAQP++  +EE  K
Sbjct  472  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKK--KEEGNK 529
Query  447  GGKGPF 452
            G KGP+
Sbjct  530  GRKGPL 535

Sequence Alignment: 6. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 434.8 bits 1880,  Expect = 6e-123
 Identities = 279/421 66%, Positives = 360/421 85%, Gaps = 5/421 1%
Query  28   HRENIDGAEVSVSRGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYR 86
            +RE+ +  +  + R KN NPF F S+R F TLF+NQ+G +RVLQRF+QRS Q+QNL +YR
Sbjct  176  QRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 234
Query  87   VVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFF 146
            ++E+ SKPNTLLLP+HADAD+L+V+LNG A+L+LVN D RDS  L+ G A ++P+GTT++
Sbjct  235  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 294
Query  147  LVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEIS 206
            +VNPD+NENLR+I LA+PVN P RF+ FFLSSTEAQQSYLQGFS+NILEAS+D+  +EI+
Sbjct  295  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 354
Query  207  RVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKP 266
            +VLF  E + QQQG++  QE VIVE+ +EQIR L+K AKSSS+K++SSED+PFNLR++ P
Sbjct  355  KVLFSRE-EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDP 413
Query  267  IYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIE 326
            IYSNKLG++FEITPEKNPQLRDLD+F+  VDM EG+LLLPH+NSKAIVILVINEG ANIE
Sbjct  414  IYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIE 473
Query  327  LVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAEN 386
            LVG +EQQ++Q+++E+  EV++YRAELSE D+F+IPA YPV +NATSNLNFFA GINAEN
Sbjct  474  LVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 533
Query  387  NQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARK 446
            NQRNFLAG +DNVIS+IP++V ++ FP S + V+KL+K Q ES FVDAQP++  +EE  K
Sbjct  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKK--KEEGNK 591
Query  447  GGKGPF 452
            G KGP+
Sbjct  592  GRKGPL 597

Sequence Alignment: 7. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 332.0 bits 1429,  Expect = 6e-92
 Identities = 282/407 69%, Positives = 359/407 88%, Gaps = 25/407 6%
Query  41   RGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLL 99
            R KN NPF+FNS R F+TLF+NQ+GH+RVLQRF++RS+Q+QNL +YR++E+ SKPNTLLL
Sbjct  205  RHKNKNPFHFNSKR-FQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 263
Query  100  PHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPD-------- 151
            PHHADAD+L+V+LNG A+LTLVN D RDS  L+ G A ++PAGTTF++VNPD        
Sbjct  264  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMI 323
Query  152  ----------DN-ENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDS 200
                      DN ENLR+I LA+PVN P RF+ FFLSST+AQQSYLQGFSKNILEAS+D+
Sbjct  324  AGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDT 383
Query  201  DIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFN 260
              +EI++VLFG E + QQQG+E  QE VIVE+ ++QIREL+KHAKSSS+K++SSED+PFN
Sbjct  384  KFEEINKVLFGRE-EGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFN 442
Query  261  LRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINE 320
            L ++ PIYSNKLG+ FEIT ++NPQLRDLD+F+  VDM EG+L+LPH+NSKAIV+LVINE
Sbjct  443  LGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINE 501
Query  321  GKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAF 380
            G+ANIELVG +EQQ++Q+++E+  EV++YRAELSE D+F+IPA YPV +NATS+LNFFAF
Sbjct  502  GEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAF 561
Query  381  GINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440
            GINAENNQRNFLAG KDNVIS+IP++V ++ FP S + ++ LIK QSES FVDAQP  Q+
Sbjct  562  GINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQP--QQ 619
Query  441  REEARKGGKGPF 452
            +EE  KG KGP+
Sbjct  620  KEEGNKGRKGPL 631

Sequence Alignment: 8. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 285.7 bits 1226,  Expect = 4e-78
 Identities = 244/424 57%, Positives = 345/424 81%, Gaps = 16/424 3%
Query  27   VHRENIDGAEVSVS--RGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLEN 84
            VHRE  +  + S S  R + NP++F+S+R F+T +RN+ G++RVL+RF+QR+ +++NL+N
Sbjct  164  VHREEREQEQDSRSDSRRQRNPYHFSSNR-FQTYYRNRNGQIRVLERFNQRTNRLENLQN 222
Query  85   YRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTT 144
            YR++E+ SKPNTL+LP H+DADF+LVVLNGRA +T+VNPD R    LEQG A ++PAGTT
Sbjct  223  YRIIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTT 282
Query  145  FFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKE 204
             +++NPDDN+NLR+ KLA+P+NNP ++ DF+ S+T+ QQSY+ GFSKN LEA+F++  +E
Sbjct  283  SYILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEE 342
Query  205  ISRVLFGE----EGQQQQQGQES--QQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQP 258
            I RVL+G+    E ++Q++GQE   Q EGVIV + ++QI+EL KHA+SSS +   SE  P
Sbjct  343  IERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGP 402
Query  259  FNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVI 318
            FNLR+ KPIYSNK+G ++EITP+ NPQ++DL++ +   ++ EG+LLLPHYNSKAI I+V+
Sbjct  403  FNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVV 462
Query  319  NEGKANIELVGQREQQKQQEEQEESWE-----VQRYRAELSEDDVFIIPATYPVAINATS 373
            +EG+ N ELVG R+QQ+QQ+EQEE +E     V+RY  +LS+ DVFIIPA +P++INA+S
Sbjct  463  DEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASS 522
Query  374  NLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVD 433
            NL ++ FGINA  NQRNFLAG +DNVI ++  EV ++TFP S E V++LIK Q +S F +
Sbjct  523  NLRLLGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFAN 582
Query  434  AQPEQQE-RE-EARKGGKGP 451
            AQP+QQ+ RE E R+G +GP
Sbjct  583  AQPQQQQQREKEGRRGRRGP 602

Sequence Alignment: 9. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 273.0 bits 1170,  Expect = 2e-74
 Identities = 237/397 59%, Positives = 326/397 82%, Gaps = 18/397 4%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            + NPF F S+R F+T++ N+ GH+R+LQRFD+RSK  +NL+NYR++E  SKP+T++LP+ 
Sbjct  5    QENPFIFKSNR-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DADF+LVVL+G+A+LT++N + R+S  LE+G   K+PAGT  +L N DDNE+LR++ LA
Sbjct  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQ---- 218
            +PVN P ++Q F+LS T+ Q S+L GFSKNILEA+F+++ +EI +VL+ E+ Q+ Q    
Sbjct  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
Query  219  ---QGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
               + QE   E VIV++ REQI EL+K+AKSSSKKS+SSE +PFNLR++ PIYSNK+G++
Sbjct  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
Query  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQRE--Q 333
            FEITPEKNPQL+DLD+F+ SV++KEGSLLLP+YNS+AIVI+ +NEGK + ELVGQR   Q
Sbjct  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQ 303
Query  334  QKQQEE------QEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAE 385
            Q+Q+EE      QEE  + +VQRYRA LS  DV++IPA +PVAINA+S+LN+  FGINA+
Sbjct  304  QEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK 363
Query  386  NNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440
            NNQRNFLAGE+DNVIS+I   V ++ FP S  +V +L+  Q +S+F +AQP Q E
Sbjct  364  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 10. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 272.1 bits 1166,  Expect = 4e-74
 Identities = 236/397 59%, Positives = 330/397 83%, Gaps = 15/397 3%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            + NPF F S+R F+T++ N+ GH+R+LQ+FD+RSK  +NL+NYR++E  SKP+TL+LP++
Sbjct  5    QENPFIFKSNR-FQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DADF+LVVL+G+AVLT++N + R+S  LE+G   K+PAGT  +L N DDNE+LR++ LA
Sbjct  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG-- 220
            +PVNNP +++ F+LS T+ Q S+L GF+K+ILEA+F++D +EI +VL+ ++ Q+ Q+   
Sbjct  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
Query  221  -----QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
                 QE  +E VIV++ REQI+EL+K+AKSSSKKS+SSE +PFNLR++ PIYSNK+G++
Sbjct  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
Query  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQR-EQQ 334
            FEITPEKNPQL+DLD+F+ SV++KEGSLLLP+YNS+AIVI+ +NEGK   ELVGQR E Q
Sbjct  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQ 303
Query  335  KQQ----EEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQ 388
            +++    EEQEE  S +VQRYRA+LS  DVF++PA +PVAINA+S+LN+  FGINA+NNQ
Sbjct  304  REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQ 363
Query  389  RNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440
            RNFLAGE+DNVIS+I   V ++ FP S  +V +L+  Q +S+F +AQP Q E
Sbjct  364  RNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 11. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 266.4 bits 1141,  Expect = 2e-72
 Identities = 234/397 58%, Positives = 323/397 81%, Gaps = 15/397 3%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            + NPF F S+R F+TL+ N+ GH+R+LQ+FD+RSK  +NL+NYR++E  SKP+TL+LP++
Sbjct  5    QENPFIFKSNR-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DADF+LVVL+G+A LT++  + R+S  LE+G A K+PAGT  +L N DDNE+LR++ LA
Sbjct  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG-- 220
            +PVN P ++Q F+LS T+ Q S L GFSKNILEA+F+++ +EI +VL+ ++ Q+ Q+   
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  221  -----QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
                 QE  +E VIV++ REQI EL+K+AKSSSKKS+SSE  PFNLR++ PIYSNK+G++
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKF 243
Query  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQK 335
            FEITPEKN QL+DLD+F+ SVD+KEGSLLLP+YNS+AIVI+ + EGK + ELVGQR + +
Sbjct  244  FEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQ 303
Query  336  -----QQEEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQ 388
                 ++EEQEE  S +VQ YRA+LS  DVF+IPA +PVAINA+S+LN+  FGINAENN+
Sbjct  304  GKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE 363
Query  389  RNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440
            RNFLAGE+DNVIS++   V ++ FP S  +V +L+K Q +S F +AQP Q+E
Sbjct  364  RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 12. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 262.5 bits 1124,  Expect = 3e-71
 Identities = 232/397 58%, Positives = 319/397 80%, Gaps = 15/397 3%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            + NPF F S+R F+TL+ N+ GH+R+LQ+FD+RSK  +NL+NYR++E  SKP TL+LP+ 
Sbjct  5    QENPFIFKSNR-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQC 63
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DADF+LVVL+G+A LT++  + R+S  LE+G   K+PAGT  +L N DDNE+LR++ L 
Sbjct  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLT 123
Query  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG-- 220
            +PVN P ++Q F+LS T+ Q S L GFSKNILEA+F+++ +EI +VL+ ++ Q+ Q+   
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  221  -----QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
                 QE  +E VIV++ REQI EL+K+AKSSSKKS+SSE  PFNLR++ PIYSNK+G++
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKF 243
Query  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQK 335
            FEITPEKN QL+DLD+F+ SVD+KEGSLLLP+YNS+AIVI+ + EGK + ELVGQR + +
Sbjct  244  FEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQ 303
Query  336  -----QQEEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQ 388
                 ++EEQEE  S +VQ YRA+LS  DVF+IPA +PVAINA+S+LN+  FGINAENN+
Sbjct  304  GKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE 363
Query  389  RNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440
            RNFLAGE+DNVIS++   V ++ FP S  +V +L+K Q +S F +AQP Q+E
Sbjct  364  RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 13. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 230.4 bits 982,  Expect = 7e-62
 Identities = 146/210 69%, Positives = 182/210 86%, Gaps = 2/210 0%
Query  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
            +K AKSSS+K++SSED+PFNL ++ PIYS KLG++FEITPEKNPQLRDLD+F+  VDM E
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
            G+LLLPH+NSKAIVILVINEG ANIELVG +EQQ++Q+++E+  EV++YRAELSE D+F+
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
Query  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
            IPA YPV +NATSNLNFFA GINAENNQRNFLAG +DNVIS+IP++V ++ FP S + V+
Sbjct  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
Query  421  KLIKKQSESQFVDAQPEQQEREEARKGGKGPF 452
            KL+K Q ES FVDAQP   E+EE  KG KGP+
Sbjct  181  KLLKNQRESYFVDAQP--NEKEEGNKGRKGPL 210

Sequence Alignment: 14. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 212.3 bits 904,  Expect = 6e-56
 Identities = 154/390 39%, Positives = 260/390 66%, Gaps = 29/390 7%
Query  41   RGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP 100
            +  +NP+YF+ +R + T FR + GH+ VL+ F  RSK ++ L+NYR+V L + PN ++LP
Sbjct  246  KQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLP 304
Query  101  HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIK 160
             H DAD +L+V  GR  L +++ D R+S  LE G   +IPAGTTF+L+N D+NE L I K
Sbjct  305  THLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAK 364
Query  161  LAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG 220
            +   ++ P ++++FF +  +  + YL  FSK ILEA++++  + +  VL    GQQ+   
Sbjct  365  FLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL----GQQR--- 417
Query  221  QESQQEGVIVELKREQIRELTKHAKSSSK----KSLSSEDQPFNLRNQKPIYSNKLGRWF 276
                 EGVI+   +EQIRELT+    S +    +   S   P+NL N++P+YSNK G+ +
Sbjct  418  -----EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAY 472
Query  277  EITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV-------- 328
            E+ PE   QL+D+D+ +   ++ +GS++ P +N+++  ++V+  G+A++E+         
Sbjct  473  EVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRH 532
Query  329  GQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAEN 386
            G R   K++EE EE    ++ +A LS+ +  ++P  +PV   ++ N N+  FAFGINA+N
Sbjct  533  GGRRGGKRHEE-EEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQN 591
Query  387  NQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
            N+ NFLAG + NV+ +I  + +++ F A  ++V++L   Q ES F    P Q++++ +R
Sbjct  592  NHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPG-PRQHQQQSSR 649

Sequence Alignment: 15. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 211.4 bits 900,  Expect = 8e-56
 Identities = 152/390 38%, Positives = 269/390 68%, Gaps = 26/390 6%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            ++NP+YF+S     +   ++ G ++ L+RF +R++ ++ +ENYRVV L + PNT++LPHH
Sbjct  66   RHNPYYFHSQS-IRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHH 124
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DA+ ++VV  GRA LTLV+ + R+S  LE G   ++PAG T +++N D NE L ++KL 
Sbjct  125  KDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLL 184
Query  163  VPVNNPHRFQDFFLSSTEA-QQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQ 221
             PVNNP + ++++ +  ++  QSYL+ FS +IL A++++    + R +           Q
Sbjct  185  QPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF----------DQ 234
Query  222  ESQQEGVIVELKREQIRELTKHAKSSSKKSLS--SEDQPFNLRNQKPIYSNKLGRWFEIT 279
            + Q+EGVI+   +E++R L++HA S+ ++     S   P +L++++P YSN++G++FE  
Sbjct  235  QEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEAC 294
Query  280  PEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQR------EQ 333
            PE++ QL+++D+++   ++K G++++PHYNSKA V++ + EG    E+          E 
Sbjct  295  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFED 354
Query  334  Q--KQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQR 389
            Q  ++QEE+E +   Q+  A L+  D+F+IPA +P+AI A+ N N+  + FGIN ENNQR
Sbjct  355  QGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQR 414
Query  390  NFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
            NFLAG+ +++I+++  E  +++F    E+++++ + Q ES FV  +  Q  R + R
Sbjct  415  NFLAGQ-NSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQSRRGQGR 468

Sequence Alignment: 16. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 211.6 bits 901,  Expect = 9e-56
 Identities = 156/390 40%, Positives = 262/390 67%, Gaps = 29/390 7%
Query  41   RGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP 100
            +  +NP+YF+ +R + T FR + GH+ VL+ F  RSK ++ L+NYR+V L + PN ++LP
Sbjct  205  KQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLP 263
Query  101  HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIK 160
             H DAD +L+V+ GR  L +++ D R+S  LE G   +IPAGTTF+L+N D+NE L I K
Sbjct  264  THLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAK 323
Query  161  LAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG 220
            +   ++ P ++++FF +  +  + YL  FSK ILEA++++  + +  VL    GQQ+   
Sbjct  324  FLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL----GQQR--- 376
Query  221  QESQQEGVIVELKREQIRELTKHAKSSSK----KSLSSEDQPFNLRNQKPIYSNKLGRWF 276
                 EGVI+   +EQIRELT+    S +    +   S   P+NL N++P+YSNK G+ +
Sbjct  377  -----EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAY 431
Query  277  EITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV-------- 328
            E+ PE   QL+D+D+ +   ++ +GS++ P +N+++  ++V+  G+A++E+         
Sbjct  432  EVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRH 491
Query  329  GQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAEN 386
            G R   K++EE+EE    ++ RA LS+ +  ++ A +PV   ++ N N+  FAFGINA+N
Sbjct  492  GGRGGGKRHEEEEEV-HYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQN 550
Query  387  NQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
            N+ NFLAG + NV+ +I  + +++ F AS ++V++L   Q ES F    P Q++++  R
Sbjct  551  NHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPG-PRQHQQQSPR 608

Sequence Alignment: 17. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 209.6 bits 892,  Expect = 4e-55
 Identities = 152/390 38%, Positives = 266/390 68%, Gaps = 26/390 6%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            ++NP+YF+S     +   ++ G ++ L+RF +R++ ++ +ENYRVV L + PNT +LPHH
Sbjct  178  RHNPYYFHSQS-IRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHH 236
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DA+ + VV  GRA LTLV+ + R+S  LE G   ++PAG T +++N D NE L ++KL 
Sbjct  237  KDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLL 296
Query  163  VPVNNPHRFQDFFLSSTEA-QQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQ 221
             PVNNP +F++++ +  ++  QSYL+ FS +IL A++++    + R +           Q
Sbjct  297  QPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF----------DQ 346
Query  222  ESQQEGVIVELKREQIRELTKHAKSSSKKSLS--SEDQPFNLRNQKPIYSNKLGRWFEIT 279
            + Q+EGVI+   +E++R L++HA S+ ++     S   P +L+++ P YSN++G++FE  
Sbjct  347  QEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEAC 406
Query  280  PEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV------GQREQ 333
            PE++ QL+++D+++   ++K G++++PHYNSKA V++ + EG    E+          E 
Sbjct  407  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEG 466
Query  334  Q--KQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQR 389
            Q  ++QEE+E +   Q+  A L+  D+F+IPA +P+AI A+ N N+  + F IN ENNQR
Sbjct  467  QGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQR 526
Query  390  NFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
            +FLAG+ +N+I+++  E  +++F    E+++++ + Q ES FV  +  Q  R + R
Sbjct  527  DFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQSRRGQGR 580

Sequence Alignment: 18. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 209.3 bits 891,  Expect = 6e-55
 Identities = 150/390 38%, Positives = 270/390 69%, Gaps = 27/390 6%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            ++NP+YF+S + + +   +  G ++ L+RF +R++ ++ +ENYRVV L + PNT++LP+H
Sbjct  375  RHNPYYFHS-QGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYH 433
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DA+ ++VV  GRA LT+V+ + R+S  LE G   ++PAG T +++N D NE L ++KL 
Sbjct  434  KDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLL 493
Query  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQE 222
             PVNNP +F++++ +  ++ +SYL+ FS +IL A++++    + R +           Q+
Sbjct  494  QPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFF----------DQQ 543
Query  223  SQQEGVIVELKREQIRELTKHAKSSSKKSLS--SEDQPFNLRNQKPIYSNKLGRWFEITP 280
             Q+EGVI+   +E++R L++HA S+ ++     S   P +L++Q+  YSN++G++FE  P
Sbjct  544  EQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACP 603
Query  281  EKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV------GQREQQ 334
            E++ QL+++D+++   ++K G++++PHYNSKA V++ + EG    E+        Q  + 
Sbjct  604  EEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEY 663
Query  335  KQQEEQEE----SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQ 388
            K + EQEE    + + Q+  A L+  D+F+IPA +P+AI A+ N N+    FGIN +NNQ
Sbjct  664  KGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQ 723
Query  389  RNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
            RNFLAG+ +N+I+++  E  +++F    E+++++ ++Q ES FV  +  Q  R + R
Sbjct  724  RNFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPME-RQSRRGQGR 778

Sequence Alignment: 19. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 195.2 bits 829,  Expect = 7e-51
 Identities = 148/383 38%, Positives = 253/383 66%, Gaps = 30/383 7%
Query  44   NNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHA 103
            +NPF+F+  R F++ FR + G++RVLQRF  R   ++ +  +R+  L + PNT++LPHH 
Sbjct  179  HNPFHFHR-RSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHC 237
Query  104  DADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAV 163
            DA+ + +V NGR  LT++  + ++S  +  G   ++PAG+T +L N D+ E L I  L  
Sbjct  238  DAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHR 297
Query  164  PVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQES 223
            PVNNP +F++FF + ++  QSYL+ FS+ ILE +F++  +++  ++ G + +++QQGQ  
Sbjct  298  PVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQ-- 355
Query  224  QQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKN 283
               G+  +  +EQIR L++ A S  +KS   E   FNL  + P YSN+ GR++E  P + 
Sbjct  356  ---GMFRKASQEQIRALSQEATSPREKS--GERFAFNLLYRTPRYSNQNGRFYEACPREF 410
Query  284  PQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVG----------QREQ 333
             QL D+++ + ++ + +GS+++PHYNSKA  ++++NEG   +E+V           + E+
Sbjct  411  RQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEE 470
Query  334  QKQQEEQEE---SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFG-----IN 383
            Q+Q++EQEE   S + ++ R++LS  D+F++PA +PV   A+ N N+    FG     IN
Sbjct  471  QQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNIN 530
Query  384  AENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQ-SESQFVDAQ 435
             ++NQR F+AG K N + +  ++  ++ F  S   V ++      ES FV  Q
Sbjct  531  PDHNQRIFVAG-KINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQ 582

Sequence Alignment: 20. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 193.8 bits 823,  Expect = 2e-50
 Identities = 152/399 38%, Positives = 256/399 64%, Gaps = 29/399 7%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            +NNP+YF+  R F+  FR + G++RVLQRF  +   ++ +  +R+  L + PNT++LPHH
Sbjct  179  RNNPYYFHR-RSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHH 237
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DA+ + VV NGR  +T+V  + ++S  +  G   +IPAG+T +L N D+ E L I  L 
Sbjct  238  CDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLH 297
Query  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQE 222
             PVNNP +FQ FF +  E  QSYL+ FS+ ILEA F++  +++  +  G + +++QQGQ 
Sbjct  298  RPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQ- 356
Query  223  SQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEK 282
                G+  +  +EQIR L++ A  +S +   SE   FNL +Q P YSN+ GR++E  P  
Sbjct  357  ----GMFRKASQEQIRALSQGA--TSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRN 410
Query  283  -NPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV-----------GQ 330
               QLR++D  + + ++ +GS+++PHYNSKA  ++++ EG  ++E+V             
Sbjct  411  FQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSS 470
Query  331  REQQKQQEEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSN--LNFFAFGI-NAE 385
            RE+++Q+E++ E  S + +R RA+LS  ++F++PA +PV   A+ N  L ++ FG+ N +
Sbjct  471  REEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQ 530
Query  386  NNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQ-SESQFVDAQPEQQEREEA 444
            +N+R F+AG+ +NV  +   +  ++ F      V ++      ES FV  +  +   E  
Sbjct  531  DNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDE-- 587
Query  445  RKGGKGPF 452
            R+G   P+
Sbjct  588  RRGSNNPL 595

Sequence Alignment: 21. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 181.1 bits 767,  Expect = 1e-46
 Identities = 232/419 55%, Positives = 328/419 78%, Gaps = 34/419 8%
Query  34   GAEVSVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSK 93
            G+EV     +NNPFYF S R F T + NQ G +RVLQRFDQRSKQ QNL+N+R+V++ ++
Sbjct  156  GSEVREETSRNNPFYFPSRR-FSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEAR 214
Query  94   PNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDN 153
            PNTL+LP HADAD +LV+  G+A +T+ N + R S  L++GHA +IP+G   +++N  DN
Sbjct  215  PNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDN 274
Query  154  ENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEE 213
            +NLR+ K+++PVN P +F+DFF +S+  Q SYLQGFS+N LEA+F+++  EI RVL+ E 
Sbjct  275  QNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEEN 334
Query  214  --GQQQQQGQE------SQQEGVIVELKREQIRELTKHAKSSSKKSLSSED--QPFNLRN 263
              G+Q+++GQ       S  EGVIV++ +E+++ELTKHAKS SKK    ED   P NLR+
Sbjct  335  AGGEQEERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRD 394
Query  264  QKPIYSNKLGRWFEITPEK-NPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGK 322
             +P  SN +GR FE+ P+K NPQL+DLDM +  V++KEG+L+LPH+NSKA+VI+V+N+G 
Sbjct  395  GEPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGT 454
Query  323  ANIELVGQREQQKQQEEQEESWE--------------VQRYRAELSEDDVFIIPATYPVA 368
             N+ELV  R++Q+Q+  +E+ WE              V+RY A L E DVFI+PA +PVA
Sbjct  455  GNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVA 514
Query  369  INATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSE 428
            INA+S L+++ FGINAENN+R FLAG+KDNVI +I  +  D+ FP SGE+V+KLIK Q E
Sbjct  515  INASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRE 574
Query  429  SQFVDAQP--------EQQEREEARKGGKGPFV 453
            S+FV A+P        E++++EE  +GGKGP++
Sbjct  575  SHFVSARPQSQSPSSPEKEDQEEENQGGKGPLL 607

Sequence Alignment: 22. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 156.7 bits 660,  Expect = 3e-39
 Identities = 229/419 54%, Positives = 326/419 77%, Gaps = 40/419 9%
Query  34   GAEVSVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSK 93
            G+ V     +NNPFYF S R F T + NQ G +RVLQRFDQRS+Q QNL+N+R+V++ +K
Sbjct  162  GSHVREETSRNNPFYFPSRR-FSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAK 220
Query  94   PNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDN 153
            PNTL+LP HADAD +LV+  G+A +T+ N + R S  L++GHA +IP+G   +++N  DN
Sbjct  221  PNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDN 280
Query  154  ENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEE 213
            +NLR+ K+++PVN P +F+DFF +S+  Q SYLQGFS+N LEA+F+++  EI RVL+ E 
Sbjct  281  QNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEEN 340
Query  214  --GQQQQQGQES-------QQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQ---PFNL 261
              G+Q+++GQ           EGVIV++ +E++ ELTKHAKS SKK    E     P NL
Sbjct  341  AGGEQEERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINL 400
Query  262  RNQKPIYSNKLGRWFEITPEK-NPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINE 320
            R  +P  SN +G+ FE+ P+K NPQL+DLDM +  V++KEG+L+LPH+NSKA+VI+V+N+
Sbjct  401  REGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNK 460
Query  321  GKANIELV---------GQREQQKQQEEQEE--SWEVQRYRAELSEDDVFIIPATYPVAI 369
            G  N+ELV         G+RE+++ ++E+EE  + EV+RY A L E DVFI+PA +PVAI
Sbjct  461  GTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAI 520
Query  370  NATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSES 429
            NA+S L+++ FGINAENN+R FLAG+KDNVI +I  +  D+ FP SGE+V+KLIK Q ES
Sbjct  521  NASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKES 580
Query  430  QFVDAQP---------------EQQEREEARKGGKGPFV 453
            +FV A+P               E++++EE  +GGKGP++
Sbjct  581  HFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPLL 619

Sequence Alignment: 23. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 129.4 bits 540,  Expect = 4e-31
 Identities = 147/406 36%, Positives = 244/406 60%, Gaps = 30/406 7%
Query  25   GIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLEN 84
            G    E  +  E+   R + NP+ F  D  F T  R   G ++VL++F +RSK ++ +EN
Sbjct  79   GSSREEGYEEEELGGEREEENPYVFE-DEDFETRVRTDEGRIQVLEKFTKRSKLLRGIEN 137
Query  85   YRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTT 144
            +RV  L + P T++ P H DA++++ V  GRA +T V  + R++  +EQG   +IPAGT 
Sbjct  138  FRVAILEANPQTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTP 197
Query  145  FFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKE 204
             +L+N D+NE L I+K+  PV+ P  F+ F  S  E  +S+ + FS  +LEA++ +   +
Sbjct  198  VYLINRDENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQ 257
Query  205  ISRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSED--QPFNLR 262
            + + LFG+           Q +GVI++  +EQIR ++KH +++ +      D  +PFNL 
Sbjct  258  LEK-LFGK-----------QTQGVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLF 305
Query  263  NQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGK 322
            +++P  SN++GR FE  P++  QL+DLD+ +   ++ +GS+  P+YNS+A  I V+ EG+
Sbjct  306  HKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGE 365
Query  323  ANIELV----------GQREQQKQQEEQEESWE-VQRYRAELSEDDVFIIPATYPVAINA 371
               E+           GQRE       +  S    Q+ R  L    VF+ PA +PVA+ A
Sbjct  366  GYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIA 425
Query  372  TSNLNF--FAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSES 429
            + N N+  + F +NA+ N R  LAG K+N+++E   E  ++ F     +V+K+ + Q + 
Sbjct  426  SRNKNLQVLCFDVNAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQ-DQ 483
Query  430  QFVDAQPEQQEREEAR 445
            +F    P +Q  E  R
Sbjct  484  EFFFPGPSRQPEEGGR 499

Sequence Alignment: 24. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 122.3 bits 509,  Expect = 5e-29
 Identities = 132/387 34%, Positives = 231/387 59%, Gaps = 27/387 6%
Query  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
            + NP+ F+SDR F     ++ G +R L  F + S+ ++ +  YRV  +  KPNT++LPH+
Sbjct  63   EENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY 121
Query  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
             DA ++L V  GR  +  V  +      LE+G    +P+G TF+LVN DD+ +LRI  L 
Sbjct  122  IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASL- 180
Query  163  VPVNNPHR--FQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG 220
            +   +  R  ++ F+++     ++    FS ++LEA+F++D++++  + FG         
Sbjct  181  LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FG--------- 230
Query  221  QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSED-QPFNLRNQKPIYSNKLGRWFEIT 279
              +++ GVI     EQIRE+ +    S++ + +SE  +PFNLRNQKP + N  GR+    
Sbjct  231  --AHRRGVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAG 288
Query  280  PEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIEL----VGQREQQK 335
            P+ NP L  +D+ +    +  G++  P +N+KA  I ++ EG+  IE+    +GQ     
Sbjct  289  PKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWS 348
Query  336  QQEEQ-EESWEVQRYRAELSEDDVFIIPATYPVAINATSN--LNFFAFGINAENNQRNFL 392
               E+  +    +R RA L    V+++PA +P+   A++N  L  + F IN   N+R FL
Sbjct  349  SPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL 408
Query  393  AGEKDNVISEIPTEVLDVTFPAS-GEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
            AG K+NV+  +  EV  ++F    GE+++++++ Q + Q +   P++Q R+E R
Sbjct  409  AG-KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKD-QVILRGPQRQRRDEPR 460

Sequence Alignment: 25. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 114.3 bits 474,  Expect = 2e-26
 Identities = 142/388 36%, Positives = 233/388 60%, Gaps = 21/388 5%
Query  41   RGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP 100
            RG+  P+ F  D+ F T FR Q G +RVLQ+F  RS+ ++ +ENYRV  L ++P T+++P
Sbjct  191  RGRI-PYVFE-DQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVP 248
Query  101  HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIK 160
            +H DA+ ++ V  GR  ++LV  D R+S  ++QG   KI AGTT +L+N D+NE L + K
Sbjct  249  NHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAK 308
Query  161  LAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG 220
            L  PV+ P  F+ FF +  E  +S+++ FS  ILEA+F++    + R++    GQQ+Q  
Sbjct  309  LLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIF----GQQRQ-- 362
Query  221  QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITP 280
                  GVIV+   EQ+R +++H +              N+  Q+P +SN+ G+  E+  
Sbjct  363  ------GVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDA 416
Query  281  EKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVG---QREQQKQQ 337
             +  QLRDLD+ +   ++ +G++  PHYNSKA  I ++ +G+   E+      R +   Q
Sbjct  417  SQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQ 476
Query  338  EEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGE 395
             E       QR  + L+   V IIPA +P    A+SN N+  + F +NA NN++  LAG 
Sbjct  477  GETRGRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGR 536
Query  396  KDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEA 444
            + NV++++  E  ++ F     +V+++ + Q E +F    P QQ++  A
Sbjct  537  R-NVMNQLEREAKELAFGMPAREVEEVSRSQQE-EFFFKGPRQQQQGRA 583

Sequence Alignment: 26. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 98.4 bits 404,  Expect = 8e-22
 Identities = 139/398 34%, Positives = 238/398 59%, Gaps = 30/398 7%
Query  29   RENIDGAEVSVSRGKN---NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENY 85
            R+  +G     S GK    NP+ F  D  F +  + + G ++VL+ F +RS+ +  +EN+
Sbjct  41   RQQEEGNSSEESYGKEQEENPYVFQ-DEHFESRVKTEEGRVQVLENFTKRSRLLSGIENF 99
Query  86   RVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTF 145
            R+  L + P+T++ P H DA+++L V  GRA +T+V  + R+S  +E+G   +IPAGT  
Sbjct  100  RLAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPV 159
Query  146  FLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEI 205
            +++N D+NE L I+K+  PV+ P  F+ F+ +  E  +S+ + FS  +LEA++    +++
Sbjct  160  YMINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQL 219
Query  206  SRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKK-SLSSEDQ-PFNLRN 263
             +V FGE           Q +G IV+  RE+IR L++H +   +   +  E   P NL +
Sbjct  220  EKV-FGE-----------QSKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLH 267
Query  264  QKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKA 323
            + P  SN++GR +E  P+ + QL+DLD+ +   ++ +GS+  P+YNS+A  I V+ EG+ 
Sbjct  268  KHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEG 327
Query  324  NIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINAT--SNLNFFAFG 381
              E+               S   Q+  A L    VF+ PA +PVA+ A+  +NL  + F 
Sbjct  328  FFEMACPHLSSS-------SGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFE 380
Query  382  INAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQER 441
            +NA  N R  LAG K N+++E   +  ++ F     +V+++ K Q ++ F     +QQE 
Sbjct  381  VNAHGNSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQE- 438
Query  442  EEARKGGK 449
             E  +GG+
Sbjct  439  -EGGRGGR 445

Sequence Alignment: 27. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 94.7 bits 388,  Expect = 1e-20
 Identities = 130/386 33%, Positives = 222/386 57%, Gaps = 19/386 4%
Query  45   NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHAD 104
            NP+ F  D  F T  + + G + VL +F +RSK ++ LE YR+  L++ P  +++P+H D
Sbjct  127  NPYVFE-DEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMD 185
Query  105  ADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVP 164
            AD ++ V  GR  +T +  + R+S  ++QG   +I AGT F++VN D+NE L I+KL  P
Sbjct  186  ADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQP 245
Query  165  VNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQ 224
            VN P  ++ F     E  +S+ + FS+ +LEA++ +   ++ + LF           E Q
Sbjct  246  VNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LF-----------EKQ 293
Query  225  QEGVIVELKREQIRELTKHAKSSSKKSLSSEDQ-PFNLRNQKPIYSNKLGRWFEITPEKN 283
             EG IV+  +EQIR +++  +  S   ++ +    FNL  + P  SN  G+ FE   +  
Sbjct  294  DEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDY 353
Query  284  PQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEES 343
            P L++LD+ +  V++ +G +  P YNS+A  I ++  G+  +E+        +   QE+S
Sbjct  354  PPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKS 413
Query  344  WE-VQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVI 400
                ++  + +  D VF++PA +P    A+ N N+  + F +NAE N R  LAG+K N+I
Sbjct  414  GPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKK-NII 472
Query  401  SEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
              +  E  ++ F   GE+V K+  KQ E  F    P+ ++ ++ R
Sbjct  473  EVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQG-PKWRQHQQGR 516

Sequence Alignment: 28. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 85.8 bits 349,  Expect = 6e-18
 Identities = 128/382 33%, Positives = 213/382 55%, Gaps = 22/382 5%
Query  45   NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHAD 104
            NP+ F  D  F T  + + G + +L +F Q+SK ++ LE YR+  L++ P  +++P H D
Sbjct  149  NPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMD 207
Query  105  ADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVP 164
            AD ++ V  GR  +T +  + R+S  + QG    I +GT F++ N D+NE L ++++  P
Sbjct  208  ADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRP 267
Query  165  VNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQ 224
            VN P  F+ F     E  +S+ + FS  ILEA++ +  K+    LF           E Q
Sbjct  268  VNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTS-KDTLEKLF-----------EKQ 315
Query  225  QEGVIVELKREQIRELTKHAKSSSKKSLSSEDQ-PFNLRNQKPIYSNKLGRWFEITPEKN 283
             +G I++  +EQ+R +++  +      ++ E    F L  + P  SNK G+ FE      
Sbjct  316  DQGTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDY 375
Query  284  PQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEES 343
            P L  LDM +   ++ +G + +P YNS+A  I ++  G+  +E+     +    +    S
Sbjct  376  PPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC--PHLSSSKSSHPS 433
Query  344  WEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVIS 401
            +  ++ RA + +D VFI+PA +P A  A+ N N+    F +NAE N R  LAG+K N+I 
Sbjct  434  Y--KKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NIIK 490
Query  402  EIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
             +  E  ++ F   GE+V K+  KQ E  F    PE ++ +E R
Sbjct  491  VMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEGR 533

Sequence Alignment: 29. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 85.6 bits 348,  Expect = 7e-18
 Identities = 129/382 33%, Positives = 213/382 55%, Gaps = 22/382 5%
Query  45   NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHAD 104
            NP+ F  D  F T  + + G + +L +F Q+SK ++ LE YR+  L++ P  +++P H D
Sbjct  151  NPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMD 209
Query  105  ADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVP 164
            AD ++ V  GR  +T +  + R+S  + QG    I +GT F++ N D+NE L ++++  P
Sbjct  210  ADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRP 269
Query  165  VNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQ 224
            VN P  F+ F     E  +S+ + FS  ILEA++ +  K+    LF           E Q
Sbjct  270  VNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTS-KDTLEKLF-----------EKQ 317
Query  225  QEGVIVELKREQIRELTKHAKSSSKKSLSSEDQ-PFNLRNQKPIYSNKLGRWFEITPEKN 283
             +G I++  +EQIR +++  +      ++ E    F L  + P  SNK G+ FE      
Sbjct  318  DQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDY 377
Query  284  PQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEES 343
            P L  LDM +   ++ +G + +P YNS+A  I ++  G+  +E+     +    +    S
Sbjct  378  PPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC--PHLSSSKSSHPS 435
Query  344  WEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVIS 401
            +  ++ RA + +D VFI+PA +P A  A+ N N+    F +NAE N R  LAG+K N+I 
Sbjct  436  Y--KKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NIIK 492
Query  402  EIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
             +  E  ++ F   GE+V K+  KQ E  F    PE ++ +E R
Sbjct  493  VMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEGR 535

Sequence Alignment: 30. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 56.4 bits 220,  Expect = 4e-09
 Identities = 116/421 27%, Positives = 210/421 49%, Gaps = 70/421 16%
Query  11   LLGILFLASLSVSFGIVHR-ENIDGAEVSVS-RGKNNPFYFNSDRWFHTLFRNQF----- 63
            +L +L+L+S S+   + ++   ++G E  V  +   +P     DR +  L R++      
Sbjct  13   ILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSP----EDRGLFILRRSKEVLKTD 68
Query  64   -GHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVN 122
             G +R++  +  R     N     +  +  +PNTL +P++ DA ++L V  G A +  + 
Sbjct  69   AGEVRLMMGYRYRG----NHSPMHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIY 124
Query  123  PDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRF----QDFFLSS 178
             +      L+ G+   IPAG++F++VN D +E L II     + +   +    Q F++  
Sbjct  125  KNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGG 184
Query  179  TEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQ--QQQGQESQQEGV---IVELK 233
                +S L GF  + L A+F+    ++  +L  + G    +  G+ ++Q      I++LK
Sbjct  185  GVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLK 244
Query  234  REQIRE-----------------------LTKH------AKSSSKKSLSSEDQPFNLRNQ 264
               ++E                       L K        +   K  L+     +NL + 
Sbjct  245  ERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDT 304
Query  265  KPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKAN 324
            +P Y N  G    I       L+  ++ +  V++K G++L PH N  A    +I  G   
Sbjct  305  EPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGT 364
Query  325  IELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSN--LNFFAFGI 382
            I++V                      A++SE DVF IP  +P    A+    L FF F  
Sbjct  365  IQVVFPNGTAAMN-------------AKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTT 411
Query  383  NAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQERE 442
            +A  N+  FL G K +++  +    L   F  S E++++++K Q E+  +   P ++  E
Sbjct  412  SARKNRPQFLVG-KSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEE 470
Query  443  EARKGGKGPFV 453
               K  KG  V
Sbjct  471  INGKKWKGEEV 481

Sequence Alignment: 31. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 52.1 bits 201,  Expect = 7e-08
 Identities = 104/394 26%, Positives = 203/394 51%, Gaps = 72/394 18%
Query  5    RIPLLLLLGILF--LASLSVSFGIVHRENIDGAEVSVSRGKNNPFYF-NSDRWFHTLFRN 61
            +  LLLLL +L   +A+ +++F   H +  +G +    +   + F   NS R    +F+ 
Sbjct  1    KTTLLLLLFVLCHGVATTTMAF---HDD--EGGD---KKSPKSLFLMSNSTR----VFKT 48
Query  62   QFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLV 121
              G +RVL+    R        +  +  +  +P +L++P++ D+++++ +  G A L ++
Sbjct  49   DAGEMRVLKSHGGRIFY----RHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAKLGFI 104
Query  122  NPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNP--HRFQDFFLSST 179
              D      L+ G    IP+G+ F+LVN  + + L +I    P  +     FQ F++   
Sbjct  105  YDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQSFYIGGG 164
Query  180  EAQQSYLQGFSKNILEASFDSD---IKEI-SRVLFG-----------------------E 212
               +S L GF   ILE +F+     ++EI S+ L G                       +
Sbjct  165  ANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDD 224
Query  213  EGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSED---QP--FNLRNQKPI 267
            + QQ ++  + Q+E    +      R+L +       + + ++D    P  +NL + K  
Sbjct  225  KEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKA 284
Query  268  -YSNKLGRWFE-ITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANI 325
             + N  G W + +   + P L + D+ +  V +  GS+L PH N  +    ++  G   +
Sbjct  285  DFKNAYG-WSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGEL 343
Query  326  ELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSN--LNFFAFGIN 383
              +G     +              + ++ + DVF++P  +P    A+ +  L FF F  +
Sbjct  344  H-IGYPNGSRA------------MKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTS 390
Query  384  AENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSES 429
            A  N+  FLAG    + + +  E L   F  S + +++ +  Q E+
Sbjct  391  ARKNKPQFLAGAASLLRTLMGPE-LSAAFGVSEDTLRRAVDAQHEA 435

Sequence Alignment: 32. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 48.9 bits 187,  Expect = 7e-07
 Identities = 64/249 25%, Positives = 117/249 46%, Gaps = 27/249 10%
Query  177  SSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQ 236
            SS E   + + GF+   LE +F  D   + R L GE+ ++ +  Q  +   V++  K E+
Sbjct  222  SSGEKSGNIFSGFADEFLEEAFQID-GGLVRKLKGEDDERDRIVQVDEDFEVLLPEKDEE 280
Query  237  IRELTKHAKSSSKKSLSSEDQPFNLRNQKPI--------YSNKLGRWFEITPEKNPQLRD 288
             R   ++ +S S+     E+    LR ++ I        ++ + GR         P LR 
Sbjct  281  ERSRGRYIESESESENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQ 340
Query  289  LDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQR 348
            + +      +   +++ PHY   +  ++    G A +++V    Q               
Sbjct  341  VRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSV------------- 387
Query  349  YRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVISEIPTE 406
            +  E+ E  V++IP  + V I   S+  F   AF  N +N   N+LAG + + +  +P  
Sbjct  388  FDGEVREGQVLMIPQNF-VVIKRASDRGFEWIAFKTN-DNAITNLLAG-RVSQMRMLPLG 444
Query  407  VLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQERE 442
            VL   +  S E+ ++L   Q E + +     Q  RE
Sbjct  445  VLSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE 480

Sequence Alignment: 33. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 42.3 bits 158,  Expect = 6e-05
 Identities = 80/289 27%, Positives = 157/289 54%, Gaps = 51/289 17%
Query  131  LEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQD----FFLSSTEAQ---- 182
            + +G    +PAG   ++ N +    L ++ LA   N+ +++      F L  +  Q    
Sbjct  154  IREGDIIALPAGVAHWIYN-NGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQQEIQG 212
Query  183  --QSYLQGFSK-------NILEASFDSDIKEISRVLFGEEGQQQQQGQ-ESQQEGVIVEL 232
              QS+ Q  S        NIL A FD +I   S   F  + Q  ++ Q E +Q G+IV +
Sbjct  213  GGQSWSQSRSSRKGQQSNNILSA-FDEEILAQS---FNIDTQLVKKLQREEKQRGIIVRV 268
Query  233  KRE-QI----RELTKHAKSSSKKSLSSEDQPFNLRN--QKPIYSNKLGRWFEITPEKNPQ 285
            K + Q+    R+  +++ +  ++++ +    +N+ +  +  +Y+ + GR   I     P 
Sbjct  269  KEDLQVLSPQRQEKEYSDNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPI 328
Query  286  LRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWE 345
            LR L + +    + + +++ PH+N  A  I+ I  G   +++V          E  ES  
Sbjct  329  LRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVS---------ENGESV- 378
Query  346  VQRYRAELSEDDVFIIPATYPVAINATSN-LNFFAFGIN--AENNQRNFLAGEKDNVISE 402
               +  E+ E  + ++P  + V   A+S+ + + +F  N  A+ +Q   LAG + +V+  
Sbjct  379  ---FDEEIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQ---LAG-RISVMRG 431
Query  403  IPTEVLDVTFPASGEKVKKLIKKQSE-SQFVDAQPEQQER 441
            +P +V+  +F  S E    L + +SE + F      Q++R
Sbjct  432  LPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQR 471

Sequence Alignment: 34. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 38.4 bits 141,  Expect = 0.001
 Identities = 65/251 25%, Positives = 130/251 51%, Gaps = 30/251 11%
Query  180  EAQQS--YLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQI 237
            + QQS   L  F + IL  SF+ D + ++R L  E+ Q+    +  +   V+   ++EQ 
Sbjct  225  QGQQSNNILSAFDEEILAQSFNIDTQ-LARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQE 283
Query  238  RELT----KHAKSSSKKSLSSEDQPFNLRN--QKPIYSNKLGRWFEITPEKNPQLRDLDM 291
            +E      +  ++  ++++ +    +N+ +  +  +Y+ + GR   +     P LR L +
Sbjct  284  QEYEEERERRQRNGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQL 343
Query  292  FIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRA 351
              +   +   ++L PH+N  A  I+ I  G   I++V          E  ES     +  
Sbjct  344  SAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVS---------ENGESV----FDE 390
Query  352  ELSEDDVFIIPATYPVAINATSN-LNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDV 410
            E+ E  + ++P  + V   A+S+ + + +F  N  + Q + LAG + +V   +P +V+  
Sbjct  391  EIREGQLVVVPQNFAVVKRASSDKFEWVSFKTNGLS-QTSQLAG-RVSVFRALPLDVIKN 448
Query  411  TFPASGEKVKKLIKKQSESQFV-----DAQPEQQEREEARK 446
            +F  S E  ++L + +SE+          +  Q ERE  R+
Sbjct  449  SFDISREDARRLKESRSETTIFAPGSSSQRKSQSERERQRE 489

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.