The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVRNKSVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDK
CEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDK
QFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRN
NPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDA
EKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPV
NNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFR
KASQEQIRALSQGATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDS
SVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQE
VERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGK
TNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFLD
FARLF
Sequence Info Allergen Name Length Opt Bits Score E Value
P09799 Gos h 2 605 4176 958.1 0
P09801 Gos h 1 588 2984 686.4 1.4e-198
B3STU4 Car i 2.0101 792 1627 377.0 2.5e-105
AAF18269 Jug r 2 593 1614 374.1 1.4e-104
AAM54366 Jug n 2 481 1463 339.7 2.6e-94
Q9SPL4 Mac i 1.0201 666 1268 295.2 9e-81
Q9SPL3 Mac i 1.0101 625 1245 290.0 3.2e-79
A0A2I4E5L6 Jug r 6.0101 502 1186 276.6 2.8e-75
AAK15089 Ses i 3 585 1086 253.7 2.4e-68
Q9FZP9 Gly m 5.0201 559 958 224.6 1.4e-59
CAA35691 Gly m conglycinin 605 951 223.0 4.6e-59
O22120 Gly m 5.0101 543 922 216.4 4e-57
ACB05815 Lup an 1.0101 611 912 214.1 2.2e-56
EF116865 Pis v 3.0101 519 884 207.7 1.5e-54
AAL86739 Cor a 11 448 880 206.8 2.4e-54
AAM73730 Ana o 1.0101 538 870 204.5 1.4e-53
AAM73729 Ana o 1.0102 536 869 204.3 1.7e-53
B1NPN8 Vig r 2.0201 454 823 193.8 2e-50
AAB23463 Gly m conglycinin 439 731 172.9 3.9e-44
Q198W3 Vig r 2.0101 453 720 170.4 2.3e-43
CAD87731 Len c 1.0102 415 673 159.7 3.5e-40
CAF25232 Pis s 1.0101 415 671 159.2 4.8e-40
CAF25233 Pis s 1.0102 415 664 157.6 1.5e-39
V9VGU0 Pin k 2.0101 463 663 157.4 1.9e-39
P43238 Ara h 1 626 583 139.1 8.5e-34
AAB01374 Gly m conglycinin 639 569 135.9 7.9e-33
CAD87730 Len c 1.0101 418 563 134.6 1.3e-32
P43237 Ara h 1 614 552 132.0 1.1e-31
AAA33947 Gly m conglycinin 218 234 59.9 2e-10
A0A516F3L2 Pru du 8.0101 264 215 55.5 5.3e-09
A0A0S3B0K0 Coc n 1.0101 490 214 55.0 1.3e-08
A5HIX6 Fag e 3.0101 136 165 44.6 4.9e-06
CAA38363 Ber e 1 154 149 40.8 7.8e-05
AAB41308 Jug r 1 139 139 38.7 0.00031
AAM54365 Jug n 1 161 134 37.4 0.0009
3EHK_A Pru du 6 531 144 39.0 0.00093
ADN39440 Pru du 6.0101 551 144 39.0 0.00098
AAB02788 Tri a glutenin 815 142 38.5 0.0021
AAL91665 Ana o 3 138 126 35.7 0.0024
AAD42943 Ses i 2 148 124 35.2 0.0037
CAA43331 Tri a glutenin 830 138 37.6 0.004
BAA11251 Tri a gliadin 279 129 35.8 0.0045
DQ631675 Pis v 1.0101 149 120 34.3 0.0071
AAA34288 Tri a gliadin 251 125 35.0 0.0074
BAN29066 Tri a 20.0101 279 125 34.9 0.0085
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 958.1 bits 4176,  Expect = 0
 Identities = 605/605 100%, Positives = 605/605 100%, Gaps = 0/605 0%
Query  1    MVRNKSVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDK 60
            MVRNKSVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDK
Sbjct  1    MVRNKSVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDK 60
Query  61   CEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDK 120
            CEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDK
Sbjct  61   CEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDK 120
Query  121  QFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRN 180
            QFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRN
Sbjct  121  QFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRN 180
Query  181  NPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDA 240
            NPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDA
Sbjct  181  NPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDA 240
Query  241  EKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPV 300
            EKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPV
Sbjct  241  EKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPV 300
Query  301  NNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFR 360
            NNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFR
Sbjct  301  NNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFR 360
Query  361  KASQEQIRALSQGATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDS 420
            KASQEQIRALSQGATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDS
Sbjct  361  KASQEQIRALSQGATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDS 420
Query  421  SVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQE 480
            SVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQE
Sbjct  421  SVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQE 480
Query  481  VERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGK 540
            VERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGK
Sbjct  481  VERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGK 540
Query  541  TNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFLD 600
            TNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFLD
Sbjct  541  TNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFLD 600
Query  601  FARLF 605
            FARLF
Sbjct  601  FARLF 605

Sequence Alignment: 2. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 686.4 bits 2984,  Expect = 1e-198
 Identities = 432/578 74%, Positives = 510/578 88%, Gaps = 12/578 2%
Query  1    MVRNKSVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDK 60
            MVRNKS  VVLLFSLFLSFGLLCSAKDFPGRR +DDP +RYEDCR+RC+ +TRGQ EQ +
Sbjct  1    MVRNKSACVVLLFSLFLSFGLLCSAKDFPGRRGDDDPPKRYEDCRRRCEWDTRGQKEQQQ 60
Query  61   CEDRSETQL--KEEQQRD-GEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQ 117
            CE+  ++Q   K++QQR   EDPQRRY++C+Q C+Q+E R RP+C+Q C +++E Q+QQQ
Sbjct  61   CEESCKSQYGEKDQQQRHRPEDPQRRYEECQQECRQQEERQRPQCQQRCLKRFE-QEQQQ 119
Query  118  PDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQ 177
              +QF+ECQQ C+ QEQRPERKQQCV+ECRE+YQE+PW+ ERE    E EEEE++EGEQ+
Sbjct  120  SQRQFQECQQHCHQQEQRPERKQQCVRECRERYQENPWRRERE---EEAEEEETEEGEQE 176
Query  178  QRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHH 237
            Q +NP++FHRRSFQ RFREEHGNFRVLQRFA +H +LRGINEFR++ILEANPNTFVLPHH
Sbjct  177  QSHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHH 236
Query  238  CDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLH 297
            CDAEKIY+VTNGRGT+TF+THENKESYNVVPGVVVR+PAGSTVYLANQDN+EKL IAVLH
Sbjct  237  CDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLH 296
Query  298  RPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQG 357
            RPVNNP QF++FFPAG + PQSYLR FSREILE  FNTRSEQLDEL GGRQSHRRQQGQG
Sbjct  297  RPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQG 356
Query  358  MFRKASQEQIRALSQGATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLRE 417
            MFRKASQEQIRALSQ ATSPR K  E +AFNLL +TPRYSNQNGRFYEACPR F+Q L +
Sbjct  357  MFRKASQEQIRALSQEATSPREKSGERFAFNLLYRTPRYSNQNGRFYEACPREFRQ-LSD 415
Query  418  VDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQE 477
            ++ +V A+++N+GSIFVPHYNSKATFVVLV EGNG+VEMV PHL RQSS     E+++++
Sbjct  416  INVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQEQ 475
Query  478  EQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQ----DNK 533
            EQE ERRSGQY+++R+QLS G++FVVPA  PVTFVASQN++L + GFGLYN       N+
Sbjct  476  EQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQ 535
Query  534  RIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRR 583
            RIFVAGK N+VRQWD QAKELAFGV SRLVDE+FNNNPQESYFVS + +R
Sbjct  536  RIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQRQR 585

Sequence Alignment: 3. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 377.0 bits 1627,  Expect = 3e-105
 Identities = 269/555 48%, Positives = 404/555 72%, Gaps = 61/555 10%
Query  30   GRRSED-----DPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQLKEEQQRDGE------ 78
            GR ++D     DP+++Y  C++ C+ + +GQ +Q +C+ R E +L+EEQ++  E      
Sbjct  198  GRDNDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQEERERRRG 257
Query  79   ---------DPQRRYQDCRQHCQ-----QEERRLRPHCEQSCREQYEKQQQ-----QQPD 119
                     DP++RY+ C+Q+C+     QE++  R  CEQ  R+Q E+++Q     Q P 
Sbjct  258  RDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQ-RQQEERERQRGRDRQDPQ 316
Query  120  KQFKECQQRCQWQEQRPERKQQCVKECREQYQEDP---WKGERENKWREEEEEESDEGEQ 176
            +Q+  CQ+RCQ QEQ PER++QC + C  QY+E     W  ++ +  RE    E    E+
Sbjct  317  QQYHRCQRRCQTQEQSPERQRQCQQRCERQYKEQQGREWGPDQASPRRESRGRE----EE 372
Query  177  QQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPH 236
            QQR+NPYYFH + ++ R     G  + L+RF ++  LLRGI  +R+ ILEANPNTFVLP+
Sbjct  373  QQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPY 432
Query  237  HCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVL 296
            H DAE + VVT GR T+TFV++E +ES+N+  G V+R+PAG+T Y+ NQD+ E+L +  L
Sbjct  433  HKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKL 492
Query  297  HRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQ 356
             +PVNNPGQF++++ AG ++ +SYLR+FS +IL A +NT  ++L+     R   +++Q +
Sbjct  493  LQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLE-----RFFDQQEQRE 547
Query  357  GMFRKASQEQIRALSQGATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQ 412
            G+  +ASQE++RALSQ A S    P G+ S G   +L SQ   YSNQ G+F+EACP   +
Sbjct  548  GVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEE-H 606
Query  413  QQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPH-LSRQSSDWSSR 471
            +QL+E+D  V   EI +G++ VPHYNSKAT VV V EG G  EM CPH +S QS ++  R
Sbjct  607  RQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGR 666
Query  472  EEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQD 531
             E+E+EE      +GQ+++V A+L+ G++FV+PAGHP+   ASQNE+L L+GFG+ NG++
Sbjct  667  REQEEEES----STGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGI-NGKN 721
Query  532  NKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG--RDRRGFDERR 589
            N+R F+AG+ N + Q +R+AKEL+F +    ++E+F     ESYFV    + RRG    +
Sbjct  722  NQRNFLAGQNNIINQLEREAKELSFNMPREEIEEIFERQV-ESYFVPMERQSRRG----Q 776
Query  590  GSNNPLSPFLDFARLF 605
            G ++PL+  LDFA +F
Sbjct  777  GRDHPLASILDFAGFF 792
 Score = 42.6 bits 160,  Expect = 0.0001
 Identities = 59/162 36%, Positives = 114/162 70%, Gaps = 37/162 22%
Query  1    MVRNKSVFVVLLFS-LFLSFGLLCSA-----KDFPGRRS-EDDPQ-QRYE--DCRKRCQL 50
            MV    + + L++S LFL+  L+CS+     +D+    +   DP+ +R+E   C++RCQ 
Sbjct  1    MVTKAKIPLFLFLSALFLA--LVCSSLALETEDLSNELNPHHDPESHRWEFQQCQERCQH 58
Query  51   ETRGQTEQDKCEDRSETQLKE-EQQR------DGEDPQRRYQDCRQHCQQEERRLRPHCE 103
            E RGQ +  +C+ R E QL+E E++R      D  +P+++Y+ CR+ C++++ R +P+CE
Sbjct  59   EERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYEQCRETCEKQDPRQQPQCE 118
Query  104  QSCREQYEKQQQQQ------------------PDKQFKECQQRCQWQEQRPERKQQCVKE 145
            + C  Q+++QQ+++                  P +Q+++C++ C+ Q Q   ++QQC   
Sbjct  119  RRCERQFQEQQERERRERRRGRDDDDKENPRDPREQYRQCEEHCRRQGQGQRQQQQCQSR 178
Query  146  CREQYQEDPWKGERENKWR 164
            C E+++E+  + E   + R
Sbjct  179  CEERFEEEQRRQEERERRR 197

Sequence Alignment: 4. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 374.1 bits 1614,  Expect = 1e-104
 Identities = 267/553 48%, Positives = 399/553 72%, Gaps = 57/553 10%
Query  30   GRRSED-----DPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQLKEEQQ-------RDG 77
            GR  +D     DP+++Y  C++ C+ + +GQ +Q +C+ R E +L+E+Q+       R G
Sbjct  2    GRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQRSQEERERRRG 61
Query  78   ED--------PQRRYQDCRQHCQ-----QEERRLRPHCEQSCREQYEKQQQ-----QQPD 119
             D        P++RY+ C+Q+C+     QE+   R  CEQ  R+Q E+++Q     Q P 
Sbjct  62   RDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCEQR-RQQEERERQRGRDRQDPQ 120
Query  120  KQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQR 179
            +Q+  CQ+RCQ QEQ PER++QC + C  QY+E   +G           E     E+QQR
Sbjct  121  QQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQ--QGRERGPEASPRRESRGREEEQQR 178
Query  180  NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD 239
            +NPYYFH +S + R   E G  + L+RF ++  LLRGI  +R+ IL+ANPNT +LPHH D
Sbjct  179  HNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKD 238
Query  240  AEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP 299
            AE + VVT GR T+T+V++E +ES+N+  G V+R+PAG+TVY+ NQD+ E+L +  L +P
Sbjct  239  AESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQP 298
Query  300  VNNPGQFQKFFPAGQENP-QSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGM 358
            VNNPGQF++++ AG ++P QSYLR+FS +IL A +NT  ++L+     R   +++Q +G+
Sbjct  299  VNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLE-----RFFDQQEQREGV 353
Query  359  FRKASQEQIRALSQGATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQ 414
              +ASQE++RALSQ A S    P G+ S G   +L S++P YSNQ G+F+EACP   ++Q
Sbjct  354  IIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEE-HRQ 412
Query  415  LREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEE 474
            L+E+D  V   EI +G++ VPHYNSKAT VV V EG G  EM CPH+S QS +   R E+
Sbjct  413  LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQ 472
Query  475  EQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKR 534
            E+EE      +G++++V A+L+ G++FV+PAGHP+   ASQNE+L LLGF + NG++N+R
Sbjct  473  EEEES-----TGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDI-NGENNQR 526
Query  535  IFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG--RDRRGFDERRGSN 592
             F+AG+ N + Q +R+AKEL+F +    ++E+F +   ESYFV    + RRG    +G +
Sbjct  527  DFLAGQNNIINQLEREAKELSFNMPREEIEEIFESQ-MESYFVPTERQSRRG----QGRD 581
Query  593  NPLSPFLDFA 602
            +PL+  LDFA
Sbjct  582  HPLASILDFA 591

Sequence Alignment: 5. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 339.7 bits 1463,  Expect = 3e-94
 Identities = 232/471 49%, Positives = 341/471 72%, Gaps = 26/471 5%
Query  113  QQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESD 172
            + +Q P +Q+  CQ+RCQ QEQ PER++QC + C  QY+E   + ER  +     E +  
Sbjct  2    RDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGR-ERGPEASPRRESKGR 60
Query  173  EGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTF 232
            E E+QQR+NPYYFH +S + R   E G  + L+RFA++  LLRGI  +R+ IL+ANPNTF
Sbjct  61   E-EEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTF 119
Query  233  VLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLT 292
            +LPHH DAE + VVT GR T+T+V++E +ES+N+  G V+R+PAG+T Y+ NQD+ E+L 
Sbjct  120  MLPHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLE 179
Query  293  IAVLHRPVNNPGQFQKFFPAGQENP-QSYLRIFSREILEAVFNTRSEQLDELPGGRQSHR 351
            +  L +PVNNPGQ ++++ AG ++P QSYLR+FS +IL A +NT  ++L+     R   +
Sbjct  180  MVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLE-----RFFDQ 234
Query  352  RQQGQGMFRKASQEQIRALSQGATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEAC 407
            ++Q +G+  +ASQE++RALSQ A S    P G+ S G   +L S+ P YSNQ G+F+EAC
Sbjct  235  QEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEAC 294
Query  408  PRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSD 467
            P   ++QL+E+D  V   EI +G++ VPHYNSKAT VV V EG G  EM CPH+S QS +
Sbjct  295  PEE-HRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFE 353
Query  468  WSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLY 527
               R E+E+EE      +G++++V A+L+ G++FV+PAGHP+   ASQNE+L LLGFG+ 
Sbjct  354  DQGRREQEEEES-----TGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGI- 407
Query  528  NGQDNKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG--RDRRGF 585
            NG++N+R F+AG+ + + Q +R+AKEL+F +    ++E+F +   ESYFV    + RRG 
Sbjct  408  NGENNQRNFLAGQNSIINQLEREAKELSFNMPREEIEEIFESQ-MESYFVPTERQSRRG- 465
Query  586  DERRGSNNPLSPFLDFA 602
               +G ++PL+  L FA
Sbjct  466  ---QGRDHPLASILGFA 479

Sequence Alignment: 6. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 295.2 bits 1268,  Expect = 9e-81
 Identities = 235/555 42%, Positives = 364/555 65%, Gaps = 61/555 10%
Query  27   DFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQLKEEQQRDGE-DPQRRYQ 85
            D+    ++DDPQ   + C++RC+ +  G  +Q  C+ R +   +EE++ + + DPQ++Y+
Sbjct  68   DWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYE 127
Query  86   DCRQHCQQEERRLRPH--CEQSCREQYEKQQ---------QQQPD--------------- 119
             C++ CQ+ E   R    C+Q C  +YEK++         QQ+ D               
Sbjct  128  QCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKR 187
Query  120  ----KQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGE 175
                +++++C++RC+ QE  P ++ QC + CREQ ++    G+  N  R       +EGE
Sbjct  188  DPQQREYEDCRRRCEQQE--PRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRY-EEGE 244
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            ++Q +NPYYF  RS+  RFR E G+  VL+ F  +  LLR +  +R+ +LEANPN FVLP
Sbjct  245  EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLP 304
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
             H DA+ I +VT GRG +  +  +N+ESYN+  G V+RIPAG+T YL N+DN E+L IA 
Sbjct  305  THLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAK 364
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQG 355
            + + ++ PGQ+++FFPAG +NP+ YL  FS+EILEA +NT++E+L  + G       QQ 
Sbjct  365  FLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLG-------QQR 417
Query  356  QGMFRKASQEQIRALSQGATSPR-------GKGSEGYAFNLLSQTPRYSNQNGRFYEACP 408
            +G+   ASQEQIR L++  +  R       G+ S G  +NL+++ P YSN+ G+ YE  P
Sbjct  418  EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRG-PYNLFNKRPLYSNKYGQAYEVKP 476
Query  409  RNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLS-RQSSD 467
             +++Q L+++D SV    I +GS+  P +N+++T VV+V  G   VEM CPHLS R+   
Sbjct  477  EDYRQ-LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGR 535
Query  468  WSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLY 527
               +  EE+E+        +Y++V+A+LS     VVP GHPV FV+S NE+L L+ FG+ 
Sbjct  536  RGGKRHEEEEDV-------HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGI- 587
Query  528  NGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFD 586
            N Q+N   F+AG+  NV +Q + QA ELAF    + V+E+FN+  +  +F   R  +   
Sbjct  588  NAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQS 647
Query  587  ERRGSNN-PLSPFLDF 601
             R      PL   LDF
Sbjct  648  SRSTKQQQPLVSILDF 663

Sequence Alignment: 7. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 290.0 bits 1245,  Expect = 3e-79
 Identities = 232/555 41%, Positives = 361/555 65%, Gaps = 61/555 10%
Query  27   DFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQLKEEQQRDGE-DPQRRYQ 85
            D+    +++DPQ   + C++RC+ +     +Q  C+ R +   +EE++ + + DPQ++Y+
Sbjct  27   DWSKYDNQEDPQTECQQCQRRCRQQESDPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYE 86
Query  86   DCRQHCQQEERRLRPH--CEQSCREQYEKQQ---------QQQPD--------------- 119
             C++ CQ+ E   R    C+Q C  +YEK++         QQ+ D               
Sbjct  87   QCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEGDNKR 146
Query  120  ----KQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGE 175
                +++++C++ C+ QE  P  + QC + C+EQ ++    G+  N  R       +EGE
Sbjct  147  DPQQREYEDCRRHCEQQE--PRLQYQCQRRCQEQQRQHGRGGDLMNPQRGGSGRY-EEGE 203
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            ++Q +NPYYF  RS+  RFR E G+  VL+ F  +  LLR +  +R+ +LEANPN FVLP
Sbjct  204  EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLP 263
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
             H DA+ I +V  GRG +  +  +N+ESYN+  G V+RIPAG+T YL N+DN E+L IA 
Sbjct  264  THLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAK 323
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQG 355
            + + ++ PGQ+++FFPAG +NP+ YL  FS+EILEA +NT++E+L  + G       QQ 
Sbjct  324  FLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLG-------QQR 376
Query  356  QGMFRKASQEQIRALSQGATSPR-------GKGSEGYAFNLLSQTPRYSNQNGRFYEACP 408
            +G+  +ASQEQIR L++  +  R       G+ S G  +NL+++ P YSN+ G+ YE  P
Sbjct  377  EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRG-PYNLFNKRPLYSNKYGQAYEVKP 435
Query  409  RNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLS-RQSSD 467
             +++Q L+++D SV    I +GS+  P +N+++T VV+V  G   VEM CPHLS R+   
Sbjct  436  EDYRQ-LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGR 494
Query  468  WSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLY 527
               +  EE+EE        +Y++VRA+LS     VV AGHPV FV+S NE+L L+ FG+ 
Sbjct  495  GGGKRHEEEEEV-------HYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGI- 546
Query  528  NGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFD 586
            N Q+N   F+AG+  NV +Q + QA ELAF    + V+E+FN+  +  +F   R  +   
Sbjct  547  NAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPRQHQQQS 606
Query  587  ERRGSNN-PLSPFLDF 601
             R      PL   LDF
Sbjct  607  PRSTKQQQPLVSILDF 622

Sequence Alignment: 8. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 276.6 bits 1186,  Expect = 3e-75
 Identities = 202/451 44%, Positives = 296/451 65%, Gaps = 27/451 5%
Query  119  DKQFKECQQRCQWQEQRPER-KQQCVKECREQYQEDPWK--GER----ENKWREEEEEES 171
            D ++K+C+++C+ Q Q  E+ K++C + C E + E   +   ER    E   REE  EE 
Sbjct  30   DPELKQCKHQCRHQRQFDEQEKEHCQRSCDEYHIEKKARERAERRRSEEGSSREEGYEEE 89
Query  172  DEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNT 231
            + G +++  NPY F    F+ R R + G  +VL++F  +  LLRGI  FR+AILEANP T
Sbjct  90   ELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQT 149
Query  232  FVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKL 291
            F+ P H DAE +  V  GR T+T V  E +E++NV  G ++RIPAG+ VYL N+D  EKL
Sbjct  150  FISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEKL 209
Query  292  TIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHR 351
             I  + RPV+ PG+F+ F  +G E+P+S+ R FS E+LEA + TR +QL++L G      
Sbjct  210  YIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEKLFG------ 263
Query  352  RQQGQGMFRKASQEQIRALSQGA-TSPR----GKGSEGYAFNLLSQTPRYSNQNGRFYEA 406
             +Q QG+  KAS+EQIR++S+   T+PR    G G   + FNL+ + P  SNQ GR++E 
Sbjct  264  -KQTQGVIIKASKEQIRSMSKHEETTPRIWPFG-GDSTHPFNLFHKRPSQSNQFGRLFET 321
Query  407  CPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSS 466
             P+  +Q L+++D  V    I KGS+  P+YNS+AT + +V EG G+ EM CPHLS   S
Sbjct  322  DPKECKQ-LQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLS---S 377
Query  467  DWSSREEEEQEEQEVERRSG-QYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFG 525
              S  + E         RSG  Y+++R +L  G +FV PAGHPV  +AS+N++L +L F 
Sbjct  378  SGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFD 437
Query  526  LYNGQDNKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRR 583
            + N Q N R  +AGK N V +++++AKELAF   +R V+++F N  QE +F  G  R+
Sbjct  438  V-NAQGNIRFPLAGKNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQE-FFFPGPSRQ 493

Sequence Alignment: 9. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 253.7 bits 1086,  Expect = 2e-68
 Identities = 226/542 41%, Positives = 359/542 66%, Gaps = 52/542 9%
Query  10   VLLFSLFLSFGLLCS-AKDFPGRRSEDD--PQQRY-----EDCRKRCQLETRGQTEQDKC 61
            ++LF+L+L+  ++ S +KD   ++ +     QQ+      E C + C+   R Q  Q + 
Sbjct  9    LVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEACIQACKEYIR-QKHQGE- 66
Query  62   EDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQ---- 117
              R    + EE+  + + P  R ++C + C+Q+    R  C + C+E+Y++++ +Q    
Sbjct  67   HGRGGGDILEEEVWNRKSPIERLRECSRGCEQQHGEQREECLRRCQEEYQREKGRQDDDN 126
Query  118  ---PDKQFKECQQRCQWQ-EQRPERKQQCVKECREQYQE----DPWKGE-RENKWREEEE 168
               P+KQ+++C+ +C+ Q E     +++C +   E+Y+E    +  +GE  E + REEE+
Sbjct  127  PTDPEKQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQ 186
Query  169  EESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEAN 228
            EE   G       PY F  + F   FR +HG  RVLQ+F D+  LLRGI  +R+AILEA 
Sbjct  187  EEQGRGRI-----PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAE 241
Query  229  PNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNR 288
            P TF++P+H DAE +  V  GRGT+++V ++ +ES N+  G +++I AG+T YL N+DN 
Sbjct  242  PQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNN 301
Query  289  EKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQ 348
            E+L +A L +PV+ PG+F+ FF AG ENP+S+++ FS EILEA FNTR ++L  + G   
Sbjct  302  ERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFG--- 358
Query  349  SHRRQQGQGMFRKASQEQIRALS---QGATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYE 405
                QQ QG+  KAS+EQ+RA+S   +G   P G  S+G   N+  Q P +SNQ G+++E
Sbjct  359  ----QQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKG-TINIYQQRPTHSNQYGQLHE 413
Query  406  ACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQS 465
                 ++Q LR++D +V    I +G++  PHYNSKAT + LV +G G+ EM CPH+SR  
Sbjct  414  VDASQYRQ-LRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSR-- 470
Query  466  SDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFG 525
                SR   + E     R    Y+RV ++L+ G + ++PAGHP   VAS N++L +L F 
Sbjct  471  ----SRGSYQGET----RGRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFE 522
Query  526  LYNGQDNKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG 579
            + N  +N++  +AG+ N + Q +R+AKELAFG+ +R V+EV + + QE +F  G
Sbjct  523  V-NANNNEKFPLAGRRNVMNQLEREAKELAFGMPAREVEEV-SRSQQEEFFFKG 574

Sequence Alignment: 10. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 224.6 bits 958,  Expect = 1e-59
 Identities = 188/514 36%, Positives = 338/514 65%, Gaps = 44/514 8%
Query  63   DRSETQLKEEQQRDGEDPQ-------RRYQDCRQHCQQEE----RRLRPHCEQSCREQYE 111
            +R   Q  E+++ +GE P+       R+ +   +H Q+EE    R+   H  +   E+ +
Sbjct  21   ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQD 80
Query  112  KQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEE--E 169
            ++++ +P +  ++ +++ +WQ ++ E+ Q   KE  E+ +ED  + E ++K  +E E  E
Sbjct  81   EREHPRPHQPHQKEEEKHEWQ-HKQEKHQG--KESEEE-EEDQDEDEEQDKESQESEGSE 136
Query  170  ESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANP 229
               E  +++  NP++F+ + FQ  F+ ++G+ RVLQRF  + + L+ + ++RI  + + P
Sbjct  137  SQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKP 196
Query  230  NTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNRE 289
            NT++LPHH DA+ + V+ NG   +T+V +++++SYN+  G  +R+PAG+T Y+ N DN E
Sbjct  197  NTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDE 256
Query  290  KLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQS 349
             L +  L  PVN PG+F+ FF +  +  QSYL+ FS+ ILEA ++T+ E+++++  GR+ 
Sbjct  257  NLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREE 316
Query  350  HRRQQGQGMFRKA-----SQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSNQNGR 402
             + QQG+  ++++     S++QIR LS+ A S   K   SE   FNL S+ P YSN+ G+
Sbjct  317  GQ-QQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGK 375
Query  403  FYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLS 462
            ++E  P     QLR++D  +   ++N+G++F+PH+NSKA  V+++ EG  ++E+V   + 
Sbjct  376  LFEITPEK-NPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV--GIK 432
Query  463  RQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLL 522
             Q      ++ ++QEEQ +E R     + RA+LS  ++FV+PAG+PV  V +   DL ++
Sbjct  433  EQ------QQRQQQEEQPLEVR-----KYRAELSEQDIFVIPAGYPV--VVNATSDLNFF 479
Query  523  GFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRD 581
             FG+ N ++N+R F+AG  +NV  Q   Q +ELAF   ++ ++ +  +   ESYFV  + 
Sbjct  480  AFGI-NAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQ-SESYFVDAQP 537
Query  582  RRGFDERRGSNNPLSPFL 599
            ++  +  +G   PLS  L
Sbjct  538  QQKEEGNKGRKGPLSSIL 555

Sequence Alignment: 11. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 223.0 bits 951,  Expect = 5e-59
 Identities = 202/564 35%, Positives = 356/564 63%, Gaps = 52/564 9%
Query  9    VVLLFSLFLSFGLLCSAKDFPGRR-------SEDDPQQRYEDCRKRCQLETRGQTEQDKC 61
            +V+L S+ +SFG+    K+ P          SE D   R + C  RC L    + E+++C
Sbjct  13   LVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERD-SYRNQACHARCNLL---KVEKEEC 68
Query  62   EDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRP----HCEQSCREQYEKQQQQQ 117
            E   E ++   + R  + P+R  Q   +  + E+ + RP      +    E++E++++Q+
Sbjct  69   E---EGEIPRPRPRP-QHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQE 124
Query  118  -PDKQFKECQQRCQWQ-----EQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEES 171
             P K+ K  ++  + +     E++ ER+    +   ++ + +  + E E + RE EE E 
Sbjct  125  WPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESED 184
Query  172  DEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNT 231
             E  +++  NP+ F    F+  F+ ++G  RVLQRF  +   L+ + ++RI  + + PNT
Sbjct  185  SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNT 244
Query  232  FVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKL 291
            ++LP+H DA+ + V+ NG   +++V +++++SY +  G  +R+P+G+T Y+ N DN E L
Sbjct  245  LLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENL 304
Query  292  TIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL-----PGG 346
             +  L  PVN PG+F+ FF +  E  QSYL+ FSR ILEA ++T+ E+++++      G 
Sbjct  305  RLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQ 364
Query  347  RQSHRRQQGQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSNQNGRFY 404
            +Q  +R Q + +  + S+EQIRALS+ A S   K   SE   FNL S+ P YSN+ G+F+
Sbjct  365  QQGEQRLQ-ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFF 423
Query  405  EACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQ 464
            E  P     QLR++D  +   ++N+G++++PH+NSKA  ++++ EG+ ++E+V   L  Q
Sbjct  424  EITPEK-NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV--GLKEQ 480
Query  465  SSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGF 524
                  ++E++QEEQ +E R     + RA+LS  ++FV+PAG+PV   A+ N  L ++  
Sbjct  481  ------QQEQQQEEQPLEVR-----KYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAI 527
Query  525  GLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRR 583
            G+ N ++N+R F+AG  +NV  Q   Q +ELAF   ++ V++++ N  +ESYFV  + ++
Sbjct  528  GI-NAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQ-RESYFVDAQPKK 585
Query  584  GFDERRGSNNPLSPFL 599
              +  +G   PLS  L
Sbjct  586  KEEGNKGRKGPLSSIL 601

Sequence Alignment: 12. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 216.4 bits 922,  Expect = 4e-57
 Identities = 196/515 38%, Positives = 327/515 63%, Gaps = 51/515 9%
Query  57   EQDKCED------RSETQLKE-EQQRDGEDPQRRYQDCR-------QHCQQEERRLRPHC 102
            E+++CE+      R   Q  E E Q+ GE  +   +  R       Q  Q+EE   R   
Sbjct  2    EKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQ 61
Query  103  EQSCREQYEKQQ-QQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGEREN 161
            E   +E+   ++  ++ D+   E Q   Q+   RP  +    KE R+Q +ED    E E 
Sbjct  62   EWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQ----KEERKQ-EED----EDEE 112
Query  162  KWREEEEEESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFR 221
            + RE EE E  E  +++  NP+ F    F+  F+ ++G  RVLQRF  +   L+ + ++R
Sbjct  113  QQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 172
Query  222  IAILEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVY 281
            I  + + PNT++LP+H DA+ + V+ NG   +++V +++++SY +  G  +R+P+G+T Y
Sbjct  173  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 232
Query  282  LANQDNREKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLD 341
            + N DN E L +  L  PVN PG+F+ FF +  E  QSYL+ FSR ILEA ++T+ E+++
Sbjct  233  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 292
Query  342  EL-----PGGRQSHRRQQGQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTP 394
            ++      G +Q  +R Q + +  + S+EQIRALS+ A S   K   SE   FNL S+ P
Sbjct  293  KVLFSREEGQQQGEQRLQ-ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDP 351
Query  395  RYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHV 454
             YSN+ G+F+E  P     QLR++D  +   ++N+G++++PH+NSKA  ++++ EG+ ++
Sbjct  352  IYSNKLGKFFEITPEK-NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANI 410
Query  455  EMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVAS 514
            E+V   L  Q      ++E++QEEQ +E R     + RA+LS  ++FV+PAG+PV   A+
Sbjct  411  ELV--GLKEQ------QQEQQQEEQPLEVR-----KYRAELSEQDIFVIPAGYPVVVNAT 457
Query  515  QNEDLGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQE 573
             N  L ++  G+ N ++N+R F+AG  +NV  Q   Q +ELAF   ++ V++++ N  +E
Sbjct  458  SN--LNFFAIGI-NAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQ-RE 513
Query  574  SYFVSGRDRRGFDERRGSNNPLSPFL 599
            SYFV  + ++  +  +G   PLS  L
Sbjct  514  SYFVDAQPKKKEEGNKGRKGPLSSIL 539

Sequence Alignment: 13. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 214.1 bits 912,  Expect = 2e-56
 Identities = 230/563 40%, Positives = 362/563 64%, Gaps = 67/563 11%
Query  7    VFVVLLFSLFL---SFGLLCSAKDFPGRRSEDDPQQRYEDCRK-RCQLETRGQTEQDKCE 62
            ++++LL  +FL   S G+    KDF    +++ P++R E+  + R Q   R Q EQ++ E
Sbjct  10   MLILLLGVVFLLAASIGIAYGEKDF----TKNPPKEREEEEHEPRQQPRPRQQEEQER-E 64
Query  63   DRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQF 122
             R       E++ DGE  + R Q    + ++ ERR   H     RE+ E++QQ +P ++ 
Sbjct  65   HR------REEKHDGEPSRGRSQSEESQEEEHERRREHH-----RER-EQEQQPRPQRRQ 112
Query  123  KECQQRCQWQ--EQRPERKQQCVKECREQYQE----------DPWKGERENKW-REEEEE 169
            +E ++  +WQ   QRP+ +++  +E REQ Q           D  +  RE +  REE E+
Sbjct  113  EEEEEEEEWQPRRQRPQSRREE-REEREQEQGSSSGSQRGGGDERRQHRERRVHREEREQ 171
Query  170  ESD-EGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEAN 228
            E D   + +++ NPY+F    FQ  +R  +G  RVL+RF  + + L  +  +RI  +++ 
Sbjct  172  EQDSRSDSRRQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSK 231
Query  229  PNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNR 288
            PNT++LP H DA+ I VV NGR T+T V  + ++ YN+  G  +R+PAG+T Y+ N D+ 
Sbjct  232  PNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDN 291
Query  289  EKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQL-------D 341
            + L +A L  P+NNPG++  F+P+  ++ QSY+  FS+  LEA FNTR E++       D
Sbjct  292  QNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDD 351
Query  342  ELPGGRQSHRRQ----QGQGMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPR 395
            EL    +  R Q    Q +G+  + S++QI+ L + A S  G+G  SE   FNL S  P 
Sbjct  352  ELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLRSNKPI 411
Query  396  YSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVE 455
            YSN+ G FYE  P +   Q+++++ S+   EIN+G++++PHYNSKA F+V+V EG G+ E
Sbjct  412  YSNKFGNFYEITP-DINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYE 470
Query  456  MVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQ 515
            +V     ++  D    EE EQ E+EV R S +       LS G++F++PAGHP++  AS 
Sbjct  471  LVGIRDQQRQQD-EQEEEYEQGEEEVRRYSDK-------LSKGDVFIIPAGHPLSINASS 522
Query  516  NEDLGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQES 574
            N  L LLGFG+ N  +N+R F+AG  +NV +Q DR+ KEL F      V+ +  N  Q+S
Sbjct  523  N--LRLLGFGI-NANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQ-QQS 578
Query  575  YFVSGR----DRRGFDERRGSNNPLSPFLD 600
            YF + +     +R  + RRG   P+S  L+
Sbjct  579  YFANAQPQQQQQREKEGRRGRRGPISSILN 608

Sequence Alignment: 14. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 207.7 bits 884,  Expect = 2e-54
 Identities = 199/501 39%, Positives = 318/501 63%, Gaps = 55/501 10%
Query  36   DPQQRYEDCRKRCQLETRGQTEQ-DKCEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQE 94
            DP+ +   C+ +C+++ +   EQ ++C    E   KE++ R+ E+            ++E
Sbjct  3    DPELK--QCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEE------------EEE 48
Query  95   ERRLRPHCEQSCREQYEKQQQQQP-DKQFKECQQRCQWQEQRPERKQQCVKECREQYQED 153
            E         S R + ++   ++P +K++ +C ++C+ Q+   ++KQ C   C+E+Y+++
Sbjct  49   EEW------GSGRGRGDEFSTHEPGEKRLSQCMKQCERQDG-GQQKQLCRFRCQEKYKKE 101
Query  154  PWKGERENKWREEEEEESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHL 213
              + E      EEEEEE DE ++++  NPY F    F  R + E+G   VL +F  +  L
Sbjct  102  --RREHSYSRDEEEEEEGDEEQEEEDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKL 159
Query  214  LRGINEFRIAILEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVR 273
            LRG+ ++R+A L ANP  FV+P+H DA+ I+ V+ GRGT+T +    +ES NV  G ++R
Sbjct  160  LRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIR 219
Query  274  IPAGSTVYLANQDNREKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVF 333
            I AG+  Y+ N D  EKL I  L +PVN PG+++ F   G ENP+S+ R FSRE+LEA +
Sbjct  220  IRAGTPFYIVNTDENEKLYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAAL 279
Query  334  NTRSEQLDELPGGRQSHRRQQGQGMFRKASQEQIRALSQGATSPR-----GKGSEGYAFN 388
             T  ++L++L         +Q +G   KAS+EQIRA+S+    P      GK S G  FN
Sbjct  280  KTPRDKLEKL-------FEKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGK-STG-TFN 330
Query  389  LLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVT 448
            L+ + P  SN  G+++E+  +++   L+E+D  V    I KG +  P YNS+AT + +V 
Sbjct  331  LFKKDPSQSNNYGQLFESEFKDYPP-LQELDIMVSYVNITKGGMSGPFYNSRATKIAIVV 389
Query  449  EGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSG-QYKRVRAQLSTGNLFVVPAGH 507
             G G +E+ CPHLS  SS  S +E           +SG  YK++ + + T ++FVVPAGH
Sbjct  390  SGEGRLEIACPHLS--SSKNSGQE-----------KSGPSYKKLSSSIRTDSVFVVPAGH 436
Query  508  PVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVF 567
            P   VAS N++L +L F + N + N R  +AGK N +   +++AKELAF  +   VD+VF
Sbjct  437  PFVTVASGNQNLEILCFEV-NAEGNIRYTLAGKKNIIEVMEKEAKELAFKTKGEEVDKVF 495
Query  568  NNNPQESYFVSGRDRR 583
                +E +F   + R+
Sbjct  496  GKQDEEFFFQGPKWRQ 511

Sequence Alignment: 15. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 206.8 bits 880,  Expect = 2e-54
 Identities = 198/426 46%, Positives = 284/426 66%, Gaps = 46/426 10%
Query  133  EQRPERKQQCVKECREQYQEDPWK---GER--ENKWREEEEEESDEGEQ----QQRNNPY 183
            ++ PE K+ C  +CR++ Q D  +   G++  E K RE ++EE +  E+    +Q  NPY
Sbjct  4    KEDPELKK-CKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPY 62
Query  184  YFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAEKI 243
             F+   F+ R + E G  +VL+ F  +  LL GI  FR+AILEANP+TF+ P H DAE +
Sbjct  63   VFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELV 122
Query  244  YVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPVNNP 303
              V  GR T+T V  E +ES+NV  G ++RIPAG+ VY+ N+D  EKL I  + +PV+ P
Sbjct  123  LFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAP 182
Query  304  GQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKAS 363
            G+F+ F+ AG E+P+S+ R FS E+LEA +  R EQL+++ G       +Q +G   KAS
Sbjct  183  GHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFG-------EQSKGSIVKAS 235
Query  364  QEQIRALSQGATSPR-----GKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREV 418
            +E+IRALSQ    P      G  S G   NLL + P  SNQ GR+YEA P + ++QL+++
Sbjct  236  REKIRALSQHEEGPPRIWPFGGESSG-PINLLHKHPSQSNQFGRLYEAHPDD-HKQLQDL 293
Query  419  DSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEE 478
            D  V    I KGS+  P+YNS+AT + +V EG G  EM CPHLS  SS            
Sbjct  294  DLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLS--SS------------ 339
Query  479  QEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVA 538
                  SG Y+++ A+L  G +FV PAGHPV  +ASQN +L +L F + N + N R  +A
Sbjct  340  ------SGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV-NAHGNSRFPLA 392
Query  539  GKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRG 590
            GK N V +++R AKELAF + SR V+ +F N  Q ++F  G +++  +  RG
Sbjct  393  GKGNIVNEFERDAKELAFNLPSREVERIFKNQDQ-AFFFPGPNKQQEEGGRG 443

Sequence Alignment: 16. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 204.5 bits 870,  Expect = 1e-53
 Identities = 203/521 38%, Positives = 321/521 61%, Gaps = 62/521 11%
Query  13   FSLFL-SFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQ-DKCEDRSETQLK 70
            FSLFL S  +LC    +    ++ DP+ +   C+ +C+++ +   +Q ++C    E   K
Sbjct  9    FSLFLVSVLVLCLGFAL----AKIDPELK--QCKHQCKVQRQYDEQQKEQCVKECEKYYK 62
Query  71   EEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQ 130
            E++ R+           R+H ++EE       E       E   ++  +K++ +C ++C+
Sbjct  63   EKKGRE-----------REHEEEEE-------EWGTGGVDEPSTHEPAEKHLSQCMRQCE 104
Query  131  WQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRNNPYYFHRRSF 190
             QE   ++KQ C   C+E+Y+++  +G+   K  ++E+E+ DE E++  N PY F    F
Sbjct  105  RQEG-GQQKQLCRFRCQERYKKE--RGQHNYKREDDEDEDEDEAEEEDEN-PYVFEDEDF 160
Query  191  QERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAEKIYVVTNGR 250
              + + E+G   +L +F  K  LL  + ++R+A+L ANP  FV+P H DA+ I+ V+ GR
Sbjct  161  TTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGR 220
Query  251  GTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPVNNPGQFQKFF 310
            GT+T +    +ES NV  G +V I +G+  Y+AN D  EKL +  + RPVN PG+F+ F 
Sbjct  221  GTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFH 280
Query  311  PAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKASQEQIRAL 370
              G ENP+S+ R FS EILEA + T  + L++L         +Q QG   KAS+EQIRA+
Sbjct  281  GPGGENPESFYRAFSWEILEAALKTSKDTLEKL-------FEKQDQGTIMKASKEQIRAM 333
Query  371  SQGATSPR----GKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFE 426
            S+    P+     + S G +F L+ + P  SN+ G+++EA  R     L ++D  V    
Sbjct  334  SRRGEGPKIWPFTEESTG-SFKLFKKDPSQSNKYGQLFEA-ERIDYPPLEKLDMVVSYAN 391
Query  427  INKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSG 486
            I KG + VP YNS+AT + +V  G G VE+ CPHLS   S   S                
Sbjct  392  ITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPS---------------- 435
Query  487  QYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNVRQ 546
             YK++RA++    +F+VPAGHP   VAS NE+L ++ F + N + N R  +AGK N ++ 
Sbjct  436  -YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV-NAEGNIRYTLAGKKNIIKV 493
Query  547  WDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERR 589
             +++AKELAF +E   VD+VF    +E +F  G + R   E R
Sbjct  494  MEKEAKELAFKMEGEEVDKVFGKQDEE-FFFQGPEWRKEKEGR 535

Sequence Alignment: 17. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 204.3 bits 869,  Expect = 2e-53
 Identities = 202/521 38%, Positives = 321/521 61%, Gaps = 62/521 11%
Query  13   FSLFL-SFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQ-DKCEDRSETQLK 70
            FSLFL S  +LC    +    ++ DP+ +   C+ +C+++ +   +Q ++C    E   K
Sbjct  7    FSLFLVSVLVLCLGFAL----AKIDPELK--QCKHQCKVQRQYDEQQKEQCVKECEKYYK 60
Query  71   EEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQ 130
            E++ R+           R+H ++EE       E       E   ++  +K++ +C ++C+
Sbjct  61   EKKGRE-----------REHEEEEE-------EWGTGGVDEPSTHEPAEKHLSQCMRQCE 102
Query  131  WQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRNNPYYFHRRSF 190
             QE   ++KQ C   C+E+Y+++  +G+   K  ++E+E+ DE E++  N PY F    F
Sbjct  103  RQEG-GQQKQLCRFRCQERYKKE--RGQHNYKREDDEDEDEDEAEEEDEN-PYVFEDEDF 158
Query  191  QERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAEKIYVVTNGR 250
              + + E+G   +L +F  K  LL  + ++R+A+L ANP  FV+P H DA+ I+ V+ GR
Sbjct  159  TTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGR 218
Query  251  GTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPVNNPGQFQKFF 310
            GT+T +    +ES NV  G +V I +G+  Y+AN D  EKL +  + RPVN PG+F+ F 
Sbjct  219  GTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFH 278
Query  311  PAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKASQEQIRAL 370
              G ENP+S+ R FS EILEA + T  + L++L         +Q QG   KAS+EQ+RA+
Sbjct  279  GPGGENPESFYRAFSWEILEAALKTSKDTLEKL-------FEKQDQGTIMKASKEQVRAM 331
Query  371  SQGATSPR----GKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFE 426
            S+    P+     + S G +F L+ + P  SN+ G+++EA  R     L ++D  V    
Sbjct  332  SRRGEGPKIWPFTEESTG-SFKLFKKDPSQSNKYGQLFEA-ERIDYPPLEKLDMVVSYAN 389
Query  427  INKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSG 486
            I KG + VP YNS+AT + +V  G G VE+ CPHLS   S   S                
Sbjct  390  ITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPS---------------- 433
Query  487  QYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNVRQ 546
             YK++RA++    +F+VPAGHP   VAS NE+L ++ F + N + N R  +AGK N ++ 
Sbjct  434  -YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV-NAEGNIRYTLAGKKNIIKV 491
Query  547  WDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERR 589
             +++AKELAF +E   VD+VF    +E +F  G + R   E R
Sbjct  492  MEKEAKELAFKMEGEEVDKVFGKQDEE-FFFQGPEWRKEKEGR 533

Sequence Alignment: 18. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 193.8 bits 823,  Expect = 2e-50
 Identities = 153/399 38%, Positives = 255/399 63%, Gaps = 29/399 7%
Query  179  RNNPYYFHR-RSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHH 237
            +NNP+YF+  R F+  FR + G++RVLQRF  +   ++ +  +R+  L + PNT++LPHH
Sbjct  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
Query  238  CDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLH 297
             DA+ + VV NGR  +T+V  + ++S  +  G   +IPAG+T +L N D+ E L I  L 
Sbjct  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
Query  298  RPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQ- 356
             PVNNP +FQ FF +  E  QSYL+ FS+ ILEA F++  +++  +  G + +++QQGQ 
Sbjct  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQE 222
Query  357  ----GMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPRYSNQNGRFYEACPRN 410
                G+  +  +EQIR L++ A S   K   SE   FNL +Q P YSN+ GR++E  P  
Sbjct  223  SQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEK 282
Query  411  FQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSS 470
               QLR++D  + + ++ +GS+++PHYNSKA  ++++ EG  ++E+V             
Sbjct  283  -NPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV-----------GQ 330
Query  471  REEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQ 530
            RE+++Q+E++ E  S + +R RA+LS  ++F++PA +PV   A+ N  L ++ FG+ N +
Sbjct  331  REQQKQQEEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSN--LNFFAFGI-NAE 385
Query  531  DNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDE-- 587
            +N+R F+AG+ +NV  +   +  ++ F      V ++      ES FV  +  +   E  
Sbjct  386  NNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQ-SESQFVDAQPEQQEREEA 444
Query  588  RRGSNNPL 595
            R+G   P+
Sbjct  445  RKGGKGPF 452

Sequence Alignment: 19. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 172.9 bits 731,  Expect = 4e-44
 Identities = 158/405 39%, Positives = 264/405 65%, Gaps = 23/405 5%
Query  176  QQQRNNPYYFHRR-SFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVL 234
            ++  NNP+YF    SFQ  F  ++   R+LQRF  +   L  + ++RI  +++ PNT +L
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  235  PHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIA 294
            PHH DA+ +  V +GR  +T+V +++++SYN+ PG   RIPAG+T YL N  + + L I 
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  295  VLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQ 354
             L  PVN PG++  FF +  +  QSYL+ FS  ILE  F++  E+++ +  G +  +RQQ
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
Query  355  GQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQ 412
             +G+  + S+EQIR LS+ A S   K   SE   FNL S+ P YSN  G+F+E  P    
Sbjct  207  -EGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEK-N 264
Query  413  QQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSRE 472
             QLR++D  + + +IN+G++++PH+NSKA  ++++ EG+ ++E+V   +  Q      ++
Sbjct  265  PQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV--GIKEQ------QQ 316
Query  473  EEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDN 532
            +++QEE+ +E      +R RA+LS  ++FV+PA +P  FV +   +L +L FG+ N ++N
Sbjct  317  KQKQEEEPLE-----VQRYRAELSEDDVFVIPAAYP--FVVNATSNLNFLAFGI-NAENN 368
Query  533  KRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGS 591
            +R F+AG+ +NV RQ +RQ +ELAF   ++ V+ ++    +ESYFV  + ++  +  +G 
Sbjct  369  QRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQ-RESYFVDAQPQQKEEGSKGR 427
Query  592  NNPLSPFL 599
              P+   L
Sbjct  428  KGPFPSIL 435

Sequence Alignment: 20. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 170.4 bits 720,  Expect = 2e-43
 Identities = 151/412 36%, Positives = 260/412 63%, Gaps = 32/412 7%
Query  166  EEEEESDEGEQQQRNNPYYFHR-RSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAI 224
            E +E  +E + + +NNP+YF+  R F+  F+ ++G++RV++RF  +   ++ +  +R+  
Sbjct  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
Query  225  LEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLAN 284
            +++ PNT++LPHH DA+ + VV NGR  +T+V  + ++SY +  G   +IPAG+T +L N
Sbjct  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
Query  285  QDNREKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELP 344
             ++ + L I  L  PVNNP +FQ FF +  E  QSYLR FS+ ILEA F++  +++D + 
Sbjct  148  PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVL 207
Query  345  GG---RQSH-RRQQGQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSN 398
             G   +Q H    Q +G+  +  +EQIR L + A S   K   S+   FNL +  P YSN
Sbjct  208  FGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSN 267
Query  399  QNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVC 458
            + GR+YE  P     QL+++D  + + ++ +G +++PHYNSKA  ++++ EG   +E+V 
Sbjct  268  KFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVG 326
Query  459  PHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNED 518
            P      SD     +++Q+E      S + +R RA+LS  ++FV+PA +PV   A+ N  
Sbjct  327  P------SD-----QQQQDE------SLEVQRYRAELSEDDVFVIPAAYPVAINATSN-- 367
Query  519  LGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFV 577
            L ++ FG+ N ++N+R F+AG+ +NV  +   +  +++F      V+++      ES+FV
Sbjct  368  LNFFAFGI-NAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQ-SESHFV 425
Query  578  SGRDRRGFDER--RGSNNPLSPFL 599
              +  +   E   +G    LS  L
Sbjct  426  DAQPEQQQREEGHKGRKGSLSSIL 449

Sequence Alignment: 21. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 159.7 bits 673,  Expect = 4e-40
 Identities = 162/394 41%, Positives = 257/394 65%, Gaps = 26/394 6%
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            +  + NP+ F    FQ  +  E+G+ R+LQ+F  +  ++  +  +R+   ++ P+T+ LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
            ++ DA+ I VV +G+  +T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL--------PGGR 347
            L  PVNNPGQ++ F+ +G +N  S+L  F++ ILEA FNT  E+++++        P  R
Sbjct  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
Query  348  QS--HRRQQ--GQGMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPRYSNQNG 401
            +S   RRQ+   + +  K S+EQI+ LS+ A S   K   SE   FNL S+ P YSN+ G
Sbjct  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
Query  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
            +F+E  P     QL+++D  V + EI +GS+++P+YNS+A  +V V EG G+ E+V    
Sbjct  242  KFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELV---- 296
Query  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
                 + + REE + EE++ E  S Q +R RA+LS G++FVVPAGHPV   AS   DL L
Sbjct  297  --GQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASS--DLNL 352
Query  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580
            +GFG+ N ++N+R F+AG+ +NV  Q  R  KELAF   SR VD ++ N  Q S+F + +
Sbjct  353  IGFGI-NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQ-SHFANAQ 410

Sequence Alignment: 22. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 159.2 bits 671,  Expect = 5e-40
 Identities = 164/394 41%, Positives = 257/394 65%, Gaps = 26/394 6%
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            +  + NP+ F    FQ  +  E+G+ R+LQ+F  +  ++  +  +R+   ++ P+T+ LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
            ++ DA+ I VV +G+ T+T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL--------PGGR 347
            L  PVN PGQ+Q F+ +G +N  S L  FS+ ILEA FNT  E+++++        P  R
Sbjct  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  348  QS--HRRQQ--GQGMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPRYSNQNG 401
            +S   RRQ+   + +  K S+EQI  LS+ A S   K   SE   FNL S+ P YSN+ G
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
Query  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
            +F+E  P    QQL+++D  V + +I +GS+++P+YNS+A  +V VTEG G  E+V    
Sbjct  242  KFFEITPEK-NQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVG--- 297
Query  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
              Q ++   +E +++EEQE E  S Q +  RA+LS G++FV+PAGHPV   AS   DL L
Sbjct  298  --QRNENQGKENDKEEEQE-EETSKQVQLYRAKLSPGDVFVIPAGHPVAINASS--DLNL 352
Query  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580
            +GFG+ N ++N+R F+AG+ +NV  Q +R  KELAF   S  VD ++ N  Q SYF + +
Sbjct  353  IGFGI-NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQ-SYFANAQ 410

Sequence Alignment: 23. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 157.6 bits 664,  Expect = 1e-39
 Identities = 164/394 41%, Positives = 255/394 64%, Gaps = 26/394 6%
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            +  + NP+ F    FQ  +  E+G+ R+LQ+F  +  ++  +  +R+   ++ P T+ LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLP 61
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
            +  DA+ I VV +G+ T+T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  62   QCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL--------PGGR 347
            L  PVN PGQ+Q F+ +G +N  S L  FS+ ILEA FNT  E+++++        P  R
Sbjct  122  LTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  348  QS--HRRQQ--GQGMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPRYSNQNG 401
            +S   RRQ+   + +  K S+EQI  LS+ A S   K   SE   FNL S+ P YSN+ G
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
Query  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
            +F+E  P    QQL+++D  V + +I +GS+++P+YNS+A  +V VTEG G  E+V    
Sbjct  242  KFFEITPEK-NQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVG--- 297
Query  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
              Q ++   +E +++EEQE E  S Q +  RA+LS G++FV+PAGHPV   AS   DL L
Sbjct  298  --QRNENQGKENDKEEEQE-EETSKQVQLYRAKLSPGDVFVIPAGHPVAINASS--DLNL 352
Query  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580
            +GFG+ N ++N+R F+AG+ +NV  Q +R  KELAF   S  VD ++ N  Q SYF + +
Sbjct  353  IGFGI-NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQ-SYFANAQ 410

Sequence Alignment: 24. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 157.4 bits 663,  Expect = 2e-39
 Identities = 155/400 38%, Positives = 237/400 59%, Gaps = 23/400 5%
Query  175  EQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVL 234
            E+++  NPY FH   F+ R   E G  R L  F +   LL GI+ +R+  +E  PNT +L
Sbjct  59   EEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVML 118
Query  235  PHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIA 294
            PH+ DA+ I  VT GRG + +V +       +  G V  +P+G T YL N D+   L IA
Sbjct  119  PHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIA 178
Query  295  VLHRPVNNP-GQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQ 353
             L R  +   G+++ F+ AG  NP++    FS ++LEA FNT  ++L+ + G   +HRR 
Sbjct  179  SLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFG---AHRR- 234
Query  354  QGQGMFRKASQEQIRALSQ--GATSPRGKGSEG-YAFNLLSQTPRYSNQNGRFYEACPRN 410
               G+   A++EQIR + +  G ++     SE    FNL +Q P + N NGRF  A P++
Sbjct  235  ---GVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKD 291
Query  411  FQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSS 470
                L  VD +V    +N G++  P +N+KAT + +V EG G +EM CPHL  Q   WSS
Sbjct  292  -NPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLG-QEHGWSS 349
Query  471  REEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQ 530
                E+  Q++      Y+RVRA+L TG ++VVPAGHP+T +AS N  L +L F + N  
Sbjct  350  --PRERGHQDIN-----YERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDI-NTS 401
Query  531  DNKRIFVAGKTNNVRQWDRQAKELAFGV-ESRLVDEVFNNNPQESYFVSGRDRRGFDERR 589
             N+R F+AGK N ++  +++ + L+F +     ++EV+    ++   + G  R+  DE R
Sbjct  402  GNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQ-KDQVILRGPQRQRRDEPR 460
Query  590  GSN 592
             S+
Sbjct  461  SSS 463

Sequence Alignment: 25. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 139.1 bits 583,  Expect = 8e-34
 Identities = 213/562 37%, Positives = 331/562 58%, Gaps = 60/562 10%
Query  6    SVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDP-QQRYEDCRKRCQLETRGQTEQDKCEDR 64
            S +++LL  L L+      AK  P ++  ++P  QR   C + CQ E     +Q  CE R
Sbjct  6    SPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQR---CLQSCQQEP-DDLKQKACESR 61
Query  65   SETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYE-KQQQQQPDKQFK 123
              T+L+        DP+  Y D R H     +R  P      R+  +    ++QP +   
Sbjct  62   C-TKLEY-------DPRCVY-DPRGHTGTTNQRSPPGERTRGRQPGDYDDDRRQPRR--- 109
Query  124  ECQQRCQWQEQRP-ER-KQQCVKECREQYQEDPWKGERENK--WREEEEEESDEG----E 175
              ++  +W    P ER +++  ++ RE ++    +  R+ +   RE E+E    G    E
Sbjct  110  --EEGGRWGPAGPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSHVRE 167
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            +  RNNP+YF  R F  R+  ++G  RVLQRF  +   ++ +   RI  +EA PNT+VLP
Sbjct  168  ETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLP 227
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
             H DA+ I V+  G+ TVT     N++S+N+  G  +RIP+G   Y+ N+ + + L +A 
Sbjct  228  KHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAK 287
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNT-----RSEQLDELPGGRQSH 350
            +  PVN PGQF+ FFPA   +  SYL+ FSR  LEA FN      R   L+E  GG Q  
Sbjct  288  ISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEE 347
Query  351  RRQQ---------GQGMFRKASQEQIRALSQGATSPRGKGSEGYA-----FNLLSQTPRY 396
            R Q+          +G+  K S+E++  L++ A S   KGSE         NL    P  
Sbjct  348  RGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDL 407
Query  397  SNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEM 456
            SN  G+++E  P     QL+++D  +   EI +G++ +PH+NSKA  +V+V +G G++E+
Sbjct  408  SNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLEL 467
Query  457  VCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQN 516
            V   + ++      REEEE E++E E  + + +R  A+L  G++F++PA HPV   AS  
Sbjct  468  VA--VRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASS- 524
Query  517  EDLGLLGFGLYNGQDNKRIFVAG-KTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESY 575
             +L LLGFG+ N ++N RIF+AG K N + Q ++QAK+LAF      V+++  N  +ES+
Sbjct  525  -ELHLLGFGI-NAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQ-KESH 581
Query  576  FVSGRDRRGFDERRGSNNPLSP 597
            FVS R       +  S +P SP
Sbjct  582  FVSARP------QSQSQSPSSP 597

Sequence Alignment: 26. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 135.9 bits 569,  Expect = 8e-33
 Identities = 208/565 36%, Positives = 368/565 65%, Gaps = 84/565 14%
Query  9    VVLLFSLFLSFGLLCSAKDFPGR----RSEDDPQQRYED--CRKRCQLETRGQTEQDKCE 62
            VV+L S+ +SFG+    K  P      RS +  +  Y +  C  RC L      E+++CE
Sbjct  13   VVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKV--EEEEECE 70
Query  63   D------------RSETQLKEEQQRDGEDPQ-------RRYQDCRQHCQQEE----RRLR 99
            +            R   Q  E+++ +GE P+       R+ +   +H Q+EE    R+  
Sbjct  71   EGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEE 130
Query  100  PHCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGER 159
             H  +   E+ +++++ +P +  ++ +++ +WQ ++ E+ Q   KE  E+ +ED  + E 
Sbjct  131  KHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQ-HKQEKHQG--KESEEE-EEDQDEDEE 186
Query  160  ENKWREEEE--EESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGI 217
            ++K  +E E  E   E  +++  NP++F+ + FQ  F+ ++G+ RVLQRF  + + L+ +
Sbjct  187  QDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNL 246
Query  218  NEFRIAILEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAG 277
             ++RI  + + PNT++LPHH DA+ + V+ NG   +T+V +++++SYN+  G  +R+PAG
Sbjct  247  RDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAG 306
Query  278  STVYLANQDNREKLTIAV-------------------LHRPVNNPGQFQKFFPAGQENPQ 318
            +T Y+ N DN E L +                     L  PVN PG+F+ FF +  +  Q
Sbjct  307  TTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQ 366
Query  319  SYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKA-----SQEQIRALSQG 373
            SYL+ FS+ ILEA ++T+ E+++++  GR+   +QQG+  ++++     S++QIR LS+ 
Sbjct  367  SYLQGFSKNILEASYDTKFEEINKVLFGRE-EGQQQGEERLQESVIVEISKKQIRELSKH 425
Query  374  ATSPRGK--GSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGS 431
            A S   K   SE   FNL S+ P YSN+ G+++E   RN   QLR++D  +   ++N+G+
Sbjct  426  AKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRN--PQLRDLDVFLSVVDMNEGA 483
Query  432  IFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRV 491
            +F+PH+NSKA  V+++ EG  ++E+V   +  Q      ++ ++QEEQ +E R     + 
Sbjct  484  LFLPHFNSKAIVVLVINEGEANIELV--GIKEQ------QQRQQQEEQPLEVR-----KY 530
Query  492  RAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQ 550
            RA+LS  ++FV+PAG+PV   A+   DL ++ FG+ N ++N+R F+AG  +NV  Q   Q
Sbjct  531  RAELSEQDIFVIPAGYPVMVNATS--DLNFFAFGI-NAENNQRNFLAGSKDNVISQIPSQ 587
Query  551  AKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFL 599
             +ELAF   ++ ++ +  +   ESYFV  + ++  +  +G   PLS  L
Sbjct  588  VQELAFPRSAKDIENLIKSQ-SESYFVDAQPQQKEEGNKGRKGPLSSIL 635

Sequence Alignment: 27. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 134.6 bits 563,  Expect = 1e-32
 Identities = 161/397 40%, Positives = 249/397 62%, Gaps = 23/397 5%
Query  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
            +  + NP+ F    FQ  +  E+G+ R+LQRF  +  ++  +  +R+   ++ P+T  LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
Query  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
            +  DA+ I VV +G+  +T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLD----ELPGGRQSHR 351
            L  PVN PGQ+Q F+ +G +N  S+L  FS+ ILEA FNT  E+++    E    +  HR
Sbjct  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
Query  352  R------QQ--GQGMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPRYSNQNG 401
            R      Q+   + +  K S+EQI  LS+ A S   K   SE   FNL S+ P YSN+ G
Sbjct  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
Query  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
            +F+E  P     QL+++D  V + EI +GS+++P+YNS+A  +V V EG G  E+V    
Sbjct  242  KFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVG--- 297
Query  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
             R  +    REE ++EE + E  + Q +R RA+LS G+++V+PAGHPV   AS   DL L
Sbjct  298  QRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASS--DLNL 355
Query  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580
            +GFG+ N ++N+R F+AG+ +NV  Q  R  KELAF   SR VD ++ N  Q S+F + +
Sbjct  356  IGFGI-NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQ-SHFANAQ 413

Sequence Alignment: 28. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 132.0 bits 552,  Expect = 1e-31
 Identities = 209/515 40%, Positives = 313/515 60%, Gaps = 73/515 14%
Query  65   SETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPH-CEQSCRE-QYEKQ--------Q 114
            S TQ K    R  E+P    Q C Q CQQE   L+   CE  C + +Y+ +         
Sbjct  21   SATQAKSPY-RKTENPCA--QRCLQSCQQEPDDLKQKACESRCTKLEYDPRCVYDTGATN 77
Query  115  QQQPDKQFKECQQRCQWQEQR--PERKQ---QCVKECREQYQEDPWKGERENKWREEEEE 169
            Q++P  +    +Q   + + R  P R++       E RE+ +E+ W+  RE+ WR    +
Sbjct  78   QRHPPGERTRGRQPGDYDDDRRQPRREEGGRWGPAEPREREREEDWRQPRED-WRRPSHQ 136
Query  170  -------ESDEGEQQ------------QRNNPYYFHRRSFQERFREEHGNFRVLQRFADK 210
                   E  EGEQ+             RNNP+YF  R F  R+  ++G  RVLQRF  +
Sbjct  137  QPRKIRPEGREGEQEWGTPGSEVREETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQR 196
Query  211  HHLLRGINEFRIAILEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGV 270
               ++ +   RI  +EA PNT+VLP H DA+ I V+  G+ TVT     N++S+N+  G 
Sbjct  197  SKQFQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGH 256
Query  271  VVRIPAGSTVYLANQDNREKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILE 330
             +RIP+G   Y+ N+ + + L +A +  PVN PGQF+ FFPA   +  SYL+ FSR  LE
Sbjct  257  ALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLE 316
Query  331  AVFNT-----RSEQLDELPGGRQSHRRQQ--------GQGMFRKASQEQIRALSQGATSP 377
            A FN      R   L+E  GG Q  R Q+         +G+  K S+E+++ L++ A S 
Sbjct  317  AAFNAEFNEIRRVLLEENAGGEQEERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSV 376
Query  378  RGKGSE----GYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIF 433
              KGSE        NL    P  SN  GR++E  P     QL+++D  +   EI +G++ 
Sbjct  377  SKKGSEEEDITNPINLRDGEPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALM 436
Query  434  VPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVR- 492
            +PH+NSKA  +V+V +G G++E+V   + ++      RE+E +EE+E E   G  + VR 
Sbjct  437  LPHFNSKAMVIVVVNKGTGNLELVA--VRKEQQQRGRREQEWEEEEEDEEEEGSNREVRR 494
Query  493  --AQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAG-KTNNVRQWDR 549
              A+L  G++F++PA HPV   AS   +L LLGFG+ N ++N RIF+AG K N + Q ++
Sbjct  495  YTARLKEGDVFIMPAAHPVAINASS--ELHLLGFGI-NAENNHRIFLAGDKDNVIDQIEK 551
Query  550  QAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSP 597
            QAK+LAF      V+++  N  +ES+FVS R +        S +P SP
Sbjct  552  QAKDLAFPGSGEQVEKLIKNQ-RESHFVSARPQ--------SQSPSSP 590

Sequence Alignment: 29. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 59.9 bits 234,  Expect = 2e-10
 Identities = 80/208 38%, Positives = 137/208 65%, Gaps = 19/208 9%
Query  374  ATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIF 433
            ++S +   SE   FNL S+ P YS + G+F+E  P     QLR++D  +   ++N+G+++
Sbjct  6    SSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEK-NPQLRDLDIFLSIVDMNEGALL 64
Query  434  VPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRA 493
            +PH+NSKA  ++++ EG+ ++E+V   L  Q      ++E++QEEQ +E R     + RA
Sbjct  65   LPHFNSKAIVILVINEGDANIELV--GLKEQ------QQEQQQEEQPLEVR-----KYRA 111
Query  494  QLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAK 552
            +LS  ++FV+PAG+PV   A+ N  L ++  G+ N ++N+R F+AG  +NV  Q   Q +
Sbjct  112  ELSEQDIFVIPAGYPVVVNATSN--LNFFAIGI-NAENNQRNFLAGSQDNVISQIPSQVQ 168
Query  553  ELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFL 599
            ELAF   ++ V++++ N  +ESYFV  +     +  +G   PLS  L
Sbjct  169  ELAFPGSAQAVEKLLKNQ-RESYFVDAQPNEKEEGNKGRKGPLSSIL 214

Sequence Alignment: 30. Allergen Name: Pru du 8.0101 Sequence ID: A0A516F3L2

 Score = 55.5 bits 215,  Expect = 5e-09
 Identities = 41/103 39%, Positives = 66/103 64%, Gaps = 7/103 6%
Query  44   CRKRCQLETRGQTEQDKCEDRSETQLKEEQQRDGEDPQRRY-QDCRQHCQQEERRLRPHC 102
            C +RC++ TR   E+ KC  R+ TQ +++    G+  Q++  Q CRQHCQ E   +R   
Sbjct  122  CLQRCKMITRDPRERLKCV-RTCTQGQQQGVFQGQQQQQQVEQQCRQHCQSERDPMR--- 177
Query  103  EQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQE 152
            +Q C+E    Q  QQ  +Q  +C+ RCQW+  R E+++QC +EC E+ ++
Sbjct  178  QQECQEYCVGQMMQQEYEQ--QCRSRCQWERPRREQQEQCQEECTEKIRQ 225

Sequence Alignment: 31. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 55.0 bits 214,  Expect = 1e-08
 Identities = 107/388 27%, Positives = 184/388 47%, Gaps = 87/388 22%
Query  164  REEEEEESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQ--RFADKHHLLRGINEFR 221
            RE+  EE      + R    +  RRS +E ++ + G  R++   R+   H      +   
Sbjct  38   REKRVEEKAPRSPEDRG--LFILRRS-KEVLKTDAGEVRLMMGYRYRGNH------SPMH 88
Query  222  IAILEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVY 281
            I  +   PNT+ +P++ DA  I  V  G   V ++         +  G V  IPAGS+ Y
Sbjct  89   IGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFY 148
Query  282  LANQDNREKLTIAV---LHRPVNNPGQF-QKFFPAGQENPQSYLRIFSREILEAVFNTRS 337
            + N D  E+L I         +   G + Q F+  G   P+S L  F    L A FN  S
Sbjct  149  IVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSS 208
Query  338  EQLDEL-------P----GGRQSHRR-------QQGQGMFRK----------ASQEQIRA 369
            +QL+ +       P     G  + +R       Q  + M ++          A QE+   
Sbjct  209  DQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDV 268
Query  370  LSQGAT--SPRGKG------------SEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL 415
             +      S  GKG            S G ++NL    P Y N  G        ++   L
Sbjct  269  WTWRCLLKSLLGKGDCRVQRKHKLAHSPG-SYNLYDTEPSYQNDYGYSIAIDGHDYSA-L 326
Query  416  REVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEE 475
            +  +  V    +  G+++ PH N  AT   ++  G+G +++V P+ +             
Sbjct  327  KHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPNGTAA----------- 375
Query  476  QEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRI 535
                           + A++S G++F +P   P   +AS    L ++GF   + + N+  
Sbjct  376  ---------------MNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTT-SARKNRPQ 419
Query  536  FVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRG 590
            F+ GK++ +          AFGV    ++ +     +E+  +     R  +E  G
Sbjct  420  FLVGKSSLLHSMRGPELAAAFGVSEEQLERIVKAQ-REAVILPTSPHREMEEING 473

Sequence Alignment: 32. Allergen Name: Fag e 3.0101 Sequence ID: A5HIX6

 Score = 44.6 bits 165,  Expect = 5e-06
 Identities = 37/106 34%, Positives = 62/106 58%, Gaps = 19/106 17%
Query  36   DPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQ--LKEEQQRD---------GEDPQRRY 84
            +P+++ E CR+RCQ  ++G  E  +C +  E +  + +E  ++           DPQ+ +
Sbjct  6    EPRRQIEHCRQRCQDRSQGFRETRECLETCEKRAGFDDEPSKEVDSYTTDTRSRDPQQEF 65
Query  85   QDCRQHCQQEER--RLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERK-QQ 141
            + CR+ CQ +E   R +  CEQ C +Q E+QQ    D++F   Q R       P R    
Sbjct  66   RQCRHRCQTQEEGGRQQRKCEQRCEKQLERQQGYD-DEEFG--QGRSNIGA--PVRNYDD 120
Query  142  CVKEC 146
            C + C
Sbjct  121  CTEMC 125

Sequence Alignment: 33. Allergen Name: Ber e 1 Sequence ID: CAA38363

 Score = 40.8 bits 149,  Expect = 8e-05
 Identities = 32/87 36%, Positives = 49/87 56%, Gaps = 8/87 9%
Query  92   QQEERRLRPHCEQSCREQYEKQQQQQPDKQF-KECQQRCQWQEQRPERK--QQCVKECRE 148
            +++E   R   EQ CREQ E+QQQ    + + ++  +   +Q  RP R+  +  + EC E
Sbjct  33   EEQEENPRGRSEQQCREQMERQQQLNHCRMYLRQQMEESPYQNPRPLRRGEEPHLDECCE 92
Query  149  QYQE-DPW---KGERENKWREEEEEESDEGEQQQR 179
            Q +  D     +G R    R+ EE E  +GEQ QR
Sbjct  93   QLERMDEMCRCEGLRMMLRRQREEMEL-QGEQMQR 126

Sequence Alignment: 34. Allergen Name: Jug r 1 Sequence ID: AAB41308

 Score = 38.7 bits 139,  Expect = 0.0003
 Identities = 34/101 33%, Positives = 57/101 56%, Gaps = 14/101 13%
Query  72   EQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQ-----YEKQQQQQPDKQFKECQ 126
            E   D ++P+RR + CR++ Q+++     HC+   R+Q     Y++  Q+Q  +Q   CQ
Sbjct  24   EIDEDIDNPRRRGEGCREQIQRQQN--LNHCQYYLRQQSRSGGYDEDNQRQHFRQC--CQ 79
Query  127  QRCQWQEQ-RPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDE-GEQQQR 179
            Q  Q  EQ + E  +Q V   R Q Q+   +GE   +  +   +  +E G   QR
Sbjct  80   QLSQMDEQCQCEGLRQVV---RRQQQQQGLRGEEMEEMVQSARDLPNECGISSQR 131

Sequence Alignment: 35. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 37.4 bits 134,  Expect = 0.0009
 Identities = 27/103 26%, Positives = 52/103 50%, Gaps = 9/103 8%
Query  35   DDPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQE 94
            D+P++R E C+++ Q     Q   + C+      L+++ +  G D   + Q  RQ CQQ 
Sbjct  52   DNPRRRGEGCQEQIQR----QQNLNHCQ----YYLRQQSRSGGYDEDNQRQHFRQCCQQL 103
Query  95   ERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKEC 146
             + +  +C+     Q  ++QQQQ   + +E ++  Q     P+      + C
Sbjct  104  SQ-IEEQCQCEGLRQAVRRQQQQQGLRGEEMEEMVQSARDLPKECGISSQRC 154

Sequence Alignment: 36. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 39.0 bits 144,  Expect = 0.0009
 Identities = 110/420 26%, Positives = 198/420 47%, Gaps = 78/420 18%
Query  106  CREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWRE 165
            C E +E+ QQ     + +E +Q  Q Q+Q  + +QQ  +E +++ Q      +++ + R+
Sbjct  88   CPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQ 147
Query  166  EEEEESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQ------RFADKHHLLRGINE 219
            +E+++  +G  QQ+     + R     R RE  G+   +        + D  + L  +N 
Sbjct  148  QEQQQGQQGRPQQQQQFRQLDRHQKTRRIRE--GDVVAIPAGVAYWSYNDGDQELVAVNL 205
Query  220  FRIAI----LEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIP 275
            F ++     L+ NP  F L  + + E      N +G     ++  ++     PG   + P
Sbjct  206  FHVSSDHNQLDQNPRKFYLAGNPENE-----FNQQGQ----SQPRQQGEQGRPGQHQQ-P 255
Query  276  AGSTVYLANQDNREKL----TIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEA 331
             G       Q N   +       +L + +N   +  + +    +N    +++  R  L+ 
Sbjct  256  FGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQV--RGNLDF 313
Query  332  VFNTRSEQLDELPGGRQSHRRQQGQGMFRKASQ-EQIRA--LSQGATSPRGKGSEGYAFN 388
            V   R  Q       R+   RQQ Q    +  Q EQ+ A  L +   S R K + G    
Sbjct  314  VQPPRGRQE------REHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNP-- 365
Query  389  LLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVT 448
               +   +S + GR       N+   LR +  S       +  I+ PH+N  A  VV V 
Sbjct  366  --ERADIFSPRAGRISTLNSHNLPI-LRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVI 422
Query  449  EGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHP 508
             GN  V++V      ++ D          +QEV++              G LF+VP  H 
Sbjct  423  RGNARVQVV-----NENGD-------AILDQEVQQ--------------GQLFIVPQNHG 456
Query  509  VTFVASQNEDLGLLGFGLYNGQDNKRIFV---AGKTNNVRQWDRQAKELAFGVESRLVDE 565
            V       +  G  GF  +  +  +  F+   AG+T+ +R    +    A+ + SR    
Sbjct  457  VI------QQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQI-SREQAR 509
Query  566  VFNNNPQESYFVSGRDRR 583
             +  N QE+  +S   +R
Sbjct  510  QLKYNRQETIALSSSQQR 527

Sequence Alignment: 37. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 39.0 bits 144,  Expect = 0.001
 Identities = 124/489 25%, Positives = 228/489 46%, Gaps = 78/489 15%
Query  38   QQRYEDCRKRC---QLETRGQTEQD-KCEDRSETQLKEEQQRDGED-PQRRYQDCRQHCQ 92
            Q R  D R +    Q+ET    ++D +C   + +++    QR+G   P   Y +  Q   
Sbjct  38   QAREPDNRIQAEAGQIETWNFNQEDFQCAGVAASRI--TIQRNGLHLPS--YSNAPQLIY 93
Query  93   QEERR-LRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQ 151
              + R +       C E +E+ QQ     + +E +Q  Q Q+Q  + +QQ  +E +++ Q
Sbjct  94   IVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQ 153
Query  152  EDPWKGERENKWREEEEEESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQ------ 205
                  +++ + R++E+++  +G  QQ+     F R     R RE  G+   +       
Sbjct  154  GRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIRE--GDVVAIPAGVAYW 211
Query  206  RFADKHHLLRGINEFRIAI----LEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENK 261
             + D  + L  +N F ++     L+ NP  F L  + + E      N +G     ++  +
Sbjct  212  SYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE-----FNQQGQ----SQPRQ 262
Query  262  ESYNVVPGVVVRIPAGSTVYLANQDNREKL----TIAVLHRPVNNPGQFQKFFPAGQENP 317
            +     PG   + P G       Q +   +       +L + +N   +  + +    +N 
Sbjct  263  QGEQGRPGQH-QQPFGRPRQQEQQGSGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNR 321
Query  318  QSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKASQEQIRALSQGATSP 377
               +R+  R  L+ V   R  Q  E    +Q + +Q+ Q   ++  Q     L +   S 
Sbjct  322  NQIIRV--RGNLDFVQPPRGRQEREHEERQQEQLQQERQ---QQGGQLMANGLEETFCSL 376
Query  378  RGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHY 437
            R K + G       +   +S + GR       N+   LR +  S       +  I+ PH+
Sbjct  377  RLKENIGNP----ERADIFSPRAGRISTLNSHNLPI-LRFLRLSAERGFFYRNGIYSPHW 431
Query  438  NSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLST 497
            N  A  VV V  GN  V++V      ++ D          +QEV++              
Sbjct  432  NVNAHSVVYVIRGNARVQVV-----NENGD-------AILDQEVQQ-------------- 465
Query  498  GNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRI-FVAGKTNNVRQWDRQAKELAF 556
            G LF+VP  H V     Q  + G+  F  +  ++N  I  +AG+T+ +R    +    A+
Sbjct  466  GQLFIVPQNHGVI---QQAGNQGFEYFA-FKTEENAFINTLAGRTSFLRALPDEVLANAY 521
Query  557  GVESRLVDEVFNNNPQESYFVSGRDRR 583
             + SR     +  N QE+  +S   +R
Sbjct  522  QI-SREQARQLKYNRQETIALSSSQQR 547

Sequence Alignment: 38. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 38.5 bits 142,  Expect = 0.002
 Identities = 38/125 30%, Positives = 65/125 52%, Gaps = 13/125 10%
Query  54   GQTEQDKCEDRSETQLKEEQQ--RDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYE 111
            GQ +Q       E QL +EQQ  + G+  Q +    RQ+ QQ  +  +P   Q       
Sbjct  324  GQLQQST----QEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTS 379
Query  112  KQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEE-EE 170
             QQ  Q   ++     +   QEQ+P + QQ   E  +Q Q+ P +G++  + R+ E+ ++
Sbjct  380  PQQLGQGQPRYYPTSPQQPGQEQQPRQLQQ--PEQGQQGQQ-PEQGQQGQQQRQGEQGQQ 436
Query  171  SDEGEQQQR---NNPYYF 185
              +G+Q Q+     P Y+
Sbjct  437  PGQGQQGQQPGQGQPGYY 454

Sequence Alignment: 39. Allergen Name: Ana o 3 Sequence ID: AAL91665

 Score = 35.7 bits 126,  Expect = 0.002
 Identities = 24/68 35%, Positives = 46/68 67%, Gaps = 12/68 17%
Query  103  EQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPER---KQQCVKECREQYQEDPWKGER 159
            EQSC+ Q+E+QQ      +F+ CQ+  + + QR  R   +Q+ ++EC ++ QE   +   
Sbjct  36   EQSCQRQFEEQQ------RFRNCQRYVKQEVQRGGRYNQRQESLRECCQELQEVDRRCRC 89
Query  160  EN---KWREEEEEESDEGEQ 176
            +N     R+ +++E  +GE+
Sbjct  90   QNLEQMVRQLQQQEQIKGEE 109

Sequence Alignment: 40. Allergen Name: Ses i 2 Sequence ID: AAD42943

 Score = 35.2 bits 124,  Expect = 0.004
 Identities = 37/135 27%, Positives = 61/135 45%, Gaps = 9/135 6%
Query  8    FVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDKCED--RS 65
            F ++L  LF +   L SA       +    ++  E+ ++ C+ E+R Q +   C    RS
Sbjct  4    FTIVLAVLFAA--ALVSASAHKTVVTTSVAEEGEEENQRGCEWESR-QCQMRHCMQWMRS 60
Query  66   -ETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKE 124
               Q +E   R  E  Q +++  R+ C  E R ++ HC         +Q QQ+   + +E
Sbjct  61   MRGQYEESFLRSAEANQGQFEHFRECCN-ELRDVKSHCRCEALRCMMRQMQQEYGME-QE 118
Query  125  CQQRCQWQEQRPERKQQCVK-ECR 147
             QQ  Q  +  P         ECR
Sbjct  119  MQQMQQMMQYLPRMCGMSYPTECR 142

Sequence Alignment: 41. Allergen Name: Tri a glutenin Sequence ID: CAA43331

 Score = 37.6 bits 138,  Expect = 0.004
 Identities = 33/128 25%, Positives = 60/128 46%, Gaps = 7/128 5%
Query  54   GQTEQDKCEDRSETQLKEEQQ--RDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYE 111
            GQ +Q       E QL +EQQ  + G+  Q +    RQ+ QQ  +  +P   Q       
Sbjct  330  GQLQQST----QEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTS 385
Query  112  KQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEE-E 170
             QQ  Q   ++     +   QEQ+P + QQ  +  + Q  E   +G++  +  + ++  +
Sbjct  386  PQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQ 445
Query  171  SDEGEQQQRNNPYYF 185
              +G+Q  +  P Y+
Sbjct  446  GQQGQQPGQGQPGYY 460

Sequence Alignment: 42. Allergen Name: Tri a gliadin Sequence ID: BAA11251

 Score = 35.8 bits 129,  Expect = 0.005
 Identities = 27/102 26%, Positives = 57/102 55%, Gaps = 6/102 5%
Query  80   PQRR-YQDCRQHCQQEERRLRPHCEQSCREQYEKQ--QQQQPDKQFKECQQRCQWQEQR- 135
            PQ++ +    Q   Q+ ++  P+ +Q+   Q ++Q  Q QQP +QF + QQ    Q Q+ 
Sbjct  13   PQQQPFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQFIQPQQPFPQQPQQT 72
Query  136  -PERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRNNP 182
             P+R QQ   + ++  Q  P + ++  +   + +++  + +Q Q++ P
Sbjct  73   YPQRPQQPFPQTQQPQQPFP-QSQQPQQPFPQPQQQFPQPQQPQQSFP 119

Sequence Alignment: 43. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 34.3 bits 120,  Expect = 0.007
 Identities = 26/63 41%, Positives = 44/63 69%, Gaps = 22/63 34%
Query  104  QSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPE----------RKQQCVKECREQYQED 153
            QSC++Q+E+QQ+      FK CQ   Q + Q+ +          ++QQC K+C ++ QE 
Sbjct  38   QSCQKQFEEQQK------FKHCQMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQE- 90
Query  154  PWKGERENKWREEEEEESDEGEQQQ 178
                  + K R +  E+  + +QQQ
Sbjct  91   -----VDKKCRCQNLEQMVKRQQQQ 110

Sequence Alignment: 44. Allergen Name: Tri a gliadin Sequence ID: AAA34288

 Score = 35.0 bits 125,  Expect = 0.007
 Identities = 26/107 24%, Positives = 56/107 52%, Gaps = 7/107 6%
Query  67   TQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQ 126
            +Q++  QQ+    P++ +    Q+   + ++  PH  Q   +Q+   Q QQP +QF + Q
Sbjct  27   SQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQ---QQFP--QPQQPQQQFLQPQ 81
Query  127  QRCQWQEQRP--ERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQ 178
            Q    Q Q+P  ++ QQ   + ++  Q  P   + + ++ + +++     + QQ
Sbjct  82   QPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 135

Sequence Alignment: 45. Allergen Name: Tri a 20.0101 Sequence ID: BAN29066

 Score = 34.9 bits 125,  Expect = 0.009
 Identities = 26/107 24%, Positives = 56/107 52%, Gaps = 7/107 6%
Query  67   TQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQ 126
            +Q++  QQ+    P++ +    Q+   + ++  PH  Q   +Q+   Q QQP +QF + Q
Sbjct  8    SQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQ---QQFP--QPQQPQQQFLQPQ 62
Query  127  QRCQWQEQRP--ERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQ 178
            Q    Q Q+P  ++ QQ   + ++  Q  P   + + ++ + +++     + QQ
Sbjct  63   QPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 116

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.